SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264732.Moth_1056 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264732.Moth_1056
Domain Number 1 Region: 308-503
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-50
Family Ribonuclease PH domain 1-like 0.00000467
Further Details:      
 
Domain Number 2 Region: 4-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-50
Family Ribonuclease PH domain 1-like 0.0000124
Further Details:      
 
Domain Number 3 Region: 466-565
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.41e-28
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 4 Region: 138-225
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.19e-26
Family Ribonuclease PH domain 2-like 0.0033
Further Details:      
 
Domain Number 5 Region: 571-656
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.79e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 
Domain Number 6 Region: 232-342
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 6.93e-20
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0074
Further Details:      
 
Domain Number 7 Region: 636-717
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.16e-17
Family Cold shock DNA-binding domain-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264732.Moth_1056
Sequence length 747
Comment (Moorella thermoacetica ATCC 39073)
Sequence
MQGVLRKTLVVAGRDLTLETGRLAKQAGGAVMVSYGGTMVLVTATASEEPREGIDFFPLT
VDYEERLYAAGKIPGGFIKREGRPSEKAILSARLIDRPIRPLFPKFYRNDVHVVATVMSV
DQDCPPNVAGIIGASAALMLSAIPFAGPIGAVSVGLIDNRPVINPTLEEDSRSSLNLTVA
GTANAIMMVEAGAKEVPEDLMLECIMQGHEEIKRIVAFINEFRAEALAMGLAKEKPELVA
PQLDPAWESRVREIATPRLREVIYRSRDEKWSKQERDKQLDACREEINNLILEGQEEALA
ANPELPGLIKELITKIEKEIVRRMILTEGIRVDGRTLEEIRPITCEVGVLSRTHGSGLFT
RGETQVLTVTTLGPISDEQILDDLGVDESKRYMHHYNFPPYSVGEARPIRAPGRREIGHG
ALAERALEPMIPSEEEFPYAIRLVSEVLGSNGSTSMGSVCGSTLSLMDAGVPIKAPVAGV
AMGLVKENDQVAILTDIQGLEDALGDMDFKVAGTKKGITALQMDIKIAGIDRSILERALE
QARRGRLFILDKILATIPEPRKELSPYAPRMLTITIDPDKIRDIIGPGGKIIKKIIEETG
VEIDVEDDGRVFIASTDAAAGERALKIIESLTQDVETGKVYNGKVTRVTDFGAFVEVIPR
VLGMPGKEGLVHISQLANERVEKVEDVVQEGDYILVKAIGFDPQGRLKLSRKEALNESTV
GEGGHRHFRRAGREGGHRGLNNRRQSR
Download sequence
Identical sequences Q2RJL9
264732.Moth_1056 YP_429913.1.14147 gi|83589904|ref|YP_429913.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]