SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264732.Moth_1388 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264732.Moth_1388
Domain Number 1 Region: 1-176
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.49e-67
Family Ferredoxin domains from multidomain proteins 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 264732.Moth_1388
Sequence length 182
Comment (Moorella thermoacetica ATCC 39073)
Sequence
MAQLGFYYDMTACIGCKTCQVACKDKNNLEVGVLFRRVYTVEGGKFPHPWFYHISLGCNH
CAQAPCVRNCPTGALYKREDGIVMQDRNKCIGCRYCVWSCPYGAPQYIASEGKVGKCNLC
ADLIDRGEQPACVAACMMRALDFGDIEELRRKYGGTADVKGLPDASITHPSITIQPADEA
RK
Download sequence
Identical sequences A0A0S6UDK8 A0A1J5P1J7 Q2RIN8
gi|83590235|ref|YP_430244.1| WP_011392901.1.11833 WP_011392901.1.24029 WP_011392901.1.35666 WP_011392901.1.46409 WP_011392901.1.52901 WP_011392901.1.64341 WP_011392901.1.90723 YP_430244.1.14147 264732.Moth_1388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]