SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264732.Moth_2319 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264732.Moth_2319
Domain Number 1 Region: 28-114
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000000111
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264732.Moth_2319
Sequence length 114
Comment (Moorella thermoacetica ATCC 39073)
Sequence
MTQEFARLKRLLDIKREEELDKRRALAWQKAREVASFLRDVYGVQQVILYGSLARGDFQK
MSDIDLYIRGFEGPYWQMLARAGRLAAPFDVSIVCAEDALPSLQEEVAREGVEL
Download sequence
Identical sequences A0A1J5NAK0 Q2RG33
2005143637 264732.Moth_2319 WP_011393801.1.24029 WP_011393801.1.46409 WP_011393801.1.52901 WP_011393801.1.64341 WP_011393801.1.90723 YP_431149.1.14147 gi|83591140|ref|YP_431149.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]