SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 265072.Mfla_2577 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  265072.Mfla_2577
Domain Number 1 Region: 148-278
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.07e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000264
Further Details:      
 
Domain Number 2 Region: 31-181
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.36e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00038
Further Details:      
 
Domain Number 3 Region: 352-419
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.02e-18
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 265072.Mfla_2577
Sequence length 419
Comment (Methylobacillus flagellatus KT)
Sequence
MKRRSFNKLALAGLLLPASWRSFASAAGAPRVVVVGAGFAGATVAKYLRVWSQGGIEVIL
IEPAQTFVSCPASNLVLGGSRQMQEISHSYDQLVQHHGVQMRQASVTGVDAHRRSIRLDD
GSHIAYDRLVLAPGVSFDYSHLNALAGMDLQSRFLHAWKAGQQTVALRQQLQAMPDGGVF
VITVPALPYRCPPGPYERACQAAYYLQRHKPRSKVLVLDANPAITSKRALFEKAWSELYP
GLVEYHASSELKDIDPGKGTLDTTFERIKFDVLNLIPPQTAGRLALDNGFGNADGRWCDV
DYVTYESRKARHVHILGDALDSGLPKSAHIATSEAKVCASAIIALLAGEEPDPTPVFANT
CYSYVSAEEAMHVANVYRYDANSGEMKPAPGGGVSHARSVEEAREARAWAVNIWHDVLG
Download sequence
Identical sequences Q1GY45
WP_011480795.1.99167 265072.Mfla_2577 gi|91776927|ref|YP_546683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]