SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 265669.LMOf2365_1348 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  265669.LMOf2365_1348
Domain Number 1 Region: 296-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-47
Family Ribonuclease PH domain 1-like 0.0000121
Further Details:      
 
Domain Number 2 Region: 7-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-46
Family Ribonuclease PH domain 1-like 0.0000226
Further Details:      
 
Domain Number 3 Region: 144-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.09e-30
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 4 Region: 452-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.63e-29
Family Ribonuclease PH domain 2-like 0.0000891
Further Details:      
 
Domain Number 5 Region: 608-696
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.45e-22
Family Cold shock DNA-binding domain-like 0.00038
Further Details:      
 
Domain Number 6 Region: 554-631
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.95e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 
Domain Number 7 Region: 238-322
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000000418
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 265669.LMOf2365_1348
Sequence length 723
Comment (Listeria monocytogenes 4b F2365)
Sequence
MSEKQVFSTEWAGKTLSVEVGQLAKQASGAALIRYGDTVVLTAAVGSKKPRPGDFFPLTV
NYEEKMYSVGKVPGGFLKREGRPSDRATLTARLIDRPIRPLFAEGFRNEVQITSTVFSVD
QDCSPEMAAMLGSSVALVISDIPFEGPIAGVDVGRIDGKYVINPTIEQAEKSDISLTVAG
TYDAINMVEAGAKEVSEEAMLEAIMFGHEEIKRLCEFQQQIIAAVGKEKREIELFVSDPE
LEAEVKAASEGKMKAAIKTEEKKAREAAIEDVKEEILESYKAKELENEAEILSEVAHILE
MIEKDEMRRLISQDKIRPDGRKVNEIRPLSSEVGMLPRVHGSGLFTRGQTQALSVCTLAP
LREHQIIDGLGTEEYKRFMHHYNFPQFSVGETGPRRAPGRREIGHGALGERALQYVIPSE
EEFPYTIRLVSEVLESNGSSSQASICGSTLAMLDAGVPIKAPVAGIAMGLVKLGDDYTIL
SDIQGMEDHFGDMDFKVAGTKDGITALQMDIKIDGLSRQILDEALTQAKEGRLHILEHLT
STISAPREELSAYAPKIITLNIKPEKIKDVIGPGGKQINAIIDETGVKIDIEQDGTVYIA
SQDQAMNRKAIAIIEDIVREVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHER
VGKVEDILKLGDEVTVKVIEVDQQGRVNLSRKALLEKKEQPEGDKKPQAEKKFYPKTKKP
ESK
Download sequence
Identical sequences A0A0B8RD33 A0A0E1R604 C1L2N7 Q71ZZ1
gi|424714205|ref|YP_007014920.1| 265669.LMOf2365_1348 634178.Lm4b_01339 gi|46907557|ref|YP_013946.1| gi|405752548|ref|YP_006676013.1| gi|406704102|ref|YP_006754456.1| gi|525723467|ref|YP_008288202.1| WP_003726541.1.100221 WP_003726541.1.100522 WP_003726541.1.10073 WP_003726541.1.101527 WP_003726541.1.101811 WP_003726541.1.10210 WP_003726541.1.102150 WP_003726541.1.10444 WP_003726541.1.10460 WP_003726541.1.1146 WP_003726541.1.11689 WP_003726541.1.12020 WP_003726541.1.12028 WP_003726541.1.12287 WP_003726541.1.12993 WP_003726541.1.13004 WP_003726541.1.13180 WP_003726541.1.13360 WP_003726541.1.13684 WP_003726541.1.13855 WP_003726541.1.14641 WP_003726541.1.14875 WP_003726541.1.15122 WP_003726541.1.15342 WP_003726541.1.15495 WP_003726541.1.15564 WP_003726541.1.15618 WP_003726541.1.16516 WP_003726541.1.1667 WP_003726541.1.16726 WP_003726541.1.16746 WP_003726541.1.1678 WP_003726541.1.1688 WP_003726541.1.17106 WP_003726541.1.17131 WP_003726541.1.17399 WP_003726541.1.18289 WP_003726541.1.18979 WP_003726541.1.19112 WP_003726541.1.19167 WP_003726541.1.19195 WP_003726541.1.19246 WP_003726541.1.19371 WP_003726541.1.19372 WP_003726541.1.19452 WP_003726541.1.19472 WP_003726541.1.19584 WP_003726541.1.20263 WP_003726541.1.20378 WP_003726541.1.20416 WP_003726541.1.20672 WP_003726541.1.21371 WP_003726541.1.21428 WP_003726541.1.21429 WP_003726541.1.21527 WP_003726541.1.21567 WP_003726541.1.21874 WP_003726541.1.22188 WP_003726541.1.22194 WP_003726541.1.22221 WP_003726541.1.23291 WP_003726541.1.233 WP_003726541.1.23624 WP_003726541.1.23781 WP_003726541.1.23828 WP_003726541.1.23848 WP_003726541.1.24048 WP_003726541.1.24115 WP_003726541.1.24847 WP_003726541.1.24934 WP_003726541.1.24975 WP_003726541.1.25300 WP_003726541.1.25456 WP_003726541.1.25616 WP_003726541.1.25746 WP_003726541.1.25896 WP_003726541.1.26170 WP_003726541.1.26634 WP_003726541.1.26957 WP_003726541.1.27132 WP_003726541.1.27860 WP_003726541.1.27948 WP_003726541.1.28098 WP_003726541.1.28722 WP_003726541.1.28792 WP_003726541.1.28818 WP_003726541.1.29331 WP_003726541.1.29558 WP_003726541.1.29562 WP_003726541.1.29569 WP_003726541.1.29634 WP_003726541.1.30273 WP_003726541.1.30660 WP_003726541.1.30851 WP_003726541.1.31329 WP_003726541.1.31966 WP_003726541.1.32061 WP_003726541.1.32140 WP_003726541.1.32240 WP_003726541.1.32597 WP_003726541.1.33016 WP_003726541.1.3314 WP_003726541.1.34369 WP_003726541.1.34698 WP_003726541.1.34790 WP_003726541.1.34911 WP_003726541.1.3511 WP_003726541.1.35402 WP_003726541.1.35452 WP_003726541.1.35738 WP_003726541.1.36108 WP_003726541.1.36115 WP_003726541.1.36749 WP_003726541.1.37023 WP_003726541.1.37466 WP_003726541.1.37723 WP_003726541.1.37900 WP_003726541.1.37951 WP_003726541.1.38396 WP_003726541.1.38471 WP_003726541.1.38575 WP_003726541.1.39000 WP_003726541.1.39218 WP_003726541.1.39496 WP_003726541.1.39794 WP_003726541.1.39895 WP_003726541.1.40556 WP_003726541.1.41222 WP_003726541.1.4166 WP_003726541.1.42310 WP_003726541.1.42525 WP_003726541.1.42994 WP_003726541.1.43135 WP_003726541.1.43304 WP_003726541.1.43768 WP_003726541.1.43916 WP_003726541.1.44092 WP_003726541.1.44161 WP_003726541.1.44230 WP_003726541.1.44749 WP_003726541.1.45512 WP_003726541.1.45541 WP_003726541.1.45778 WP_003726541.1.4587 WP_003726541.1.45883 WP_003726541.1.45893 WP_003726541.1.46277 WP_003726541.1.46456 WP_003726541.1.46566 WP_003726541.1.46711 WP_003726541.1.46725 WP_003726541.1.46834 WP_003726541.1.46981 WP_003726541.1.47001 WP_003726541.1.47075 WP_003726541.1.47431 WP_003726541.1.47518 WP_003726541.1.4753 WP_003726541.1.48007 WP_003726541.1.48161 WP_003726541.1.48175 WP_003726541.1.48235 WP_003726541.1.48440 WP_003726541.1.48854 WP_003726541.1.49458 WP_003726541.1.49507 WP_003726541.1.49754 WP_003726541.1.51493 WP_003726541.1.5175 WP_003726541.1.52420 WP_003726541.1.52782 WP_003726541.1.52829 WP_003726541.1.53426 WP_003726541.1.53603 WP_003726541.1.54508 WP_003726541.1.54750 WP_003726541.1.54884 WP_003726541.1.5514 WP_003726541.1.55423 WP_003726541.1.55494 WP_003726541.1.56269 WP_003726541.1.5671 WP_003726541.1.57106 WP_003726541.1.57228 WP_003726541.1.57913 WP_003726541.1.58 WP_003726541.1.58083 WP_003726541.1.58491 WP_003726541.1.58544 WP_003726541.1.58966 WP_003726541.1.59113 WP_003726541.1.59542 WP_003726541.1.59720 WP_003726541.1.60132 WP_003726541.1.60295 WP_003726541.1.60543 WP_003726541.1.60674 WP_003726541.1.60762 WP_003726541.1.61274 WP_003726541.1.6236 WP_003726541.1.62375 WP_003726541.1.62494 WP_003726541.1.63209 WP_003726541.1.63315 WP_003726541.1.64147 WP_003726541.1.64413 WP_003726541.1.64587 WP_003726541.1.64796 WP_003726541.1.65392 WP_003726541.1.65561 WP_003726541.1.66138 WP_003726541.1.66285 WP_003726541.1.66596 WP_003726541.1.66993 WP_003726541.1.67551 WP_003726541.1.67573 WP_003726541.1.67654 WP_003726541.1.67926 WP_003726541.1.68236 WP_003726541.1.68282 WP_003726541.1.68497 WP_003726541.1.68517 WP_003726541.1.69603 WP_003726541.1.6982 WP_003726541.1.6991 WP_003726541.1.70100 WP_003726541.1.70122 WP_003726541.1.7026 WP_003726541.1.70590 WP_003726541.1.70736 WP_003726541.1.71381 WP_003726541.1.71437 WP_003726541.1.71763 WP_003726541.1.71858 WP_003726541.1.71904 WP_003726541.1.72264 WP_003726541.1.72623 WP_003726541.1.72813 WP_003726541.1.73152 WP_003726541.1.73263 WP_003726541.1.73448 WP_003726541.1.73508 WP_003726541.1.73613 WP_003726541.1.74148 WP_003726541.1.74436 WP_003726541.1.74728 WP_003726541.1.74823 WP_003726541.1.74956 WP_003726541.1.7504 WP_003726541.1.7528 WP_003726541.1.7553 WP_003726541.1.7565 WP_003726541.1.75838 WP_003726541.1.75869 WP_003726541.1.76254 WP_003726541.1.77261 WP_003726541.1.7738 WP_003726541.1.77594 WP_003726541.1.77675 WP_003726541.1.77849 WP_003726541.1.78088 WP_003726541.1.78717 WP_003726541.1.79149 WP_003726541.1.79259 WP_003726541.1.79821 WP_003726541.1.80693 WP_003726541.1.81140 WP_003726541.1.81315 WP_003726541.1.82480 WP_003726541.1.82974 WP_003726541.1.83015 WP_003726541.1.83130 WP_003726541.1.83755 WP_003726541.1.8465 WP_003726541.1.84895 WP_003726541.1.84974 WP_003726541.1.85194 WP_003726541.1.85317 WP_003726541.1.8539 WP_003726541.1.85576 WP_003726541.1.85890 WP_003726541.1.86571 WP_003726541.1.87179 WP_003726541.1.87294 WP_003726541.1.87329 WP_003726541.1.87436 WP_003726541.1.87903 WP_003726541.1.88211 WP_003726541.1.88422 WP_003726541.1.88463 WP_003726541.1.88768 WP_003726541.1.88783 WP_003726541.1.88800 WP_003726541.1.88877 WP_003726541.1.88895 WP_003726541.1.88974 WP_003726541.1.89014 WP_003726541.1.89387 WP_003726541.1.90326 WP_003726541.1.90741 WP_003726541.1.90857 WP_003726541.1.90963 WP_003726541.1.91084 WP_003726541.1.92288 WP_003726541.1.9243 WP_003726541.1.92963 WP_003726541.1.93014 WP_003726541.1.93325 WP_003726541.1.93421 WP_003726541.1.93490 WP_003726541.1.93534 WP_003726541.1.93558 WP_003726541.1.94233 WP_003726541.1.94401 WP_003726541.1.94554 WP_003726541.1.95197 WP_003726541.1.95696 WP_003726541.1.96422 WP_003726541.1.96449 WP_003726541.1.96605 WP_003726541.1.96708 WP_003726541.1.96751 WP_003726541.1.96835 WP_003726541.1.97469 WP_003726541.1.97589 WP_003726541.1.9768 WP_003726541.1.97803 WP_003726541.1.99553 WP_003726541.1.99702 WP_003726541.1.99818 WP_003726541.1.99906 gi|226223932|ref|YP_002758039.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]