SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 265669.LMOf2365_1418 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  265669.LMOf2365_1418
Domain Number 1 Region: 316-467
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.47e-31
Family HD domain 0.015
Further Details:      
 
Domain Number 2 Region: 208-304
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.23e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 265669.LMOf2365_1418
Sequence length 520
Comment (Listeria monocytogenes 4b F2365)
Sequence
MTIAITIISSLLFLIVGLVVGSLIFKSSTEKKLAAARGTAELIVEDAKKEAETTKKEALL
EAKEENHRLRTEIENELRGRRTETQKAENRLLQREENLDRKDTSLSKREATLERKEESIS
KRQQQIEEKESKLAEMIQAEQTELERISALSKEEAKSIILNQVEEELTHDTAIMVKESEN
RAKEESDKKAKNILSLAIQRCAADHVAETTVSVVTLPNDEMKGRIIGREGRNIRTLETLT
GIDLIIDDTPEAVILSGFDPIRREIARIALEKLVQDGRIHPARIEEMVDKARKEVDEHIR
EVGEQATFEVGIHSIHPDLIKILGRLRYRTSYGQNVLNHSLEVSKLAGILAGELGEDVTL
AKRAGLLHDIGKAIDHEIEGSHVEIGVELATKYKENDVVINSIASHHGDTEATSVIAVLV
AAADALSAARPGARSETLENYIRRLEKLEEISESYDGVEKSYAIQAGREVRIIVEPDTID
DLSSYRLARDIRKRIEEELDYPGHIKVTVIRETRAVEYAK
Download sequence
Identical sequences A0A0D8X2I8 A0A0E1R663 A0A241SPI6 A0A2G8Q2Y0 A0A2G8QD98 A0A2G8QJ84 A0A2G8QV43 A0A2G8QZ03 G2JZ15 H1GDG7 P0A4Q7 P0DJP2 Q71ZS1
gi|405755530|ref|YP_006678994.1| gi|550897624|ref|YP_008667120.1| gi|46907627|ref|YP_014016.1| gi|404413477|ref|YP_006699064.1| gi|404283890|ref|YP_006684787.1| gi|405749743|ref|YP_006673209.1| gi|404286820|ref|YP_006693406.1| gi|226224000|ref|YP_002758107.1| gi|525733804|ref|YP_008289648.1| LkR83 LmR126 NYSGXRC-6278b gi|405752619|ref|YP_006676084.1| gi|470207171|ref|YP_007603746.1| gi|424714275|ref|YP_007014990.1| gi|284994927|ref|YP_003416695.1| gi|404280955|ref|YP_006681853.1| gi|386053652|ref|YP_005971210.1| gi|405758446|ref|YP_006687722.1| gi|16803439|ref|NP_464924.1| gi|406704172|ref|YP_006754526.1| gi|386047051|ref|YP_005965383.1| gi|386732138|ref|YP_006205634.1| gi|16800504|ref|NP_470772.1| gi|470210299|ref|YP_007606873.1| gi|404410697|ref|YP_006696285.1| 169963.lmo1399 265669.LMOf2365_1418 272626.lin1436 634178.Lm4b_01408 gi|284801785|ref|YP_003413650.1| gi|386043710|ref|YP_005962515.1| gi|386050375|ref|YP_005968366.1| NP_464924.1.42710 WP_003721904.1.100045 WP_003721904.1.100078 WP_003721904.1.100112 WP_003721904.1.100142 WP_003721904.1.100147 WP_003721904.1.100160 WP_003721904.1.100221 WP_003721904.1.100229 WP_003721904.1.100261 WP_003721904.1.10039 WP_003721904.1.100458 WP_003721904.1.100510 WP_003721904.1.100522 WP_003721904.1.100530 WP_003721904.1.10073 WP_003721904.1.101057 WP_003721904.1.101093 WP_003721904.1.10112 WP_003721904.1.101144 WP_003721904.1.101184 WP_003721904.1.101252 WP_003721904.1.101354 WP_003721904.1.101368 WP_003721904.1.101527 WP_003721904.1.101529 WP_003721904.1.101688 WP_003721904.1.101752 WP_003721904.1.10176 WP_003721904.1.101772 WP_003721904.1.101811 WP_003721904.1.10182 WP_003721904.1.10186 WP_003721904.1.101945 WP_003721904.1.10198 WP_003721904.1.10210 WP_003721904.1.102145 WP_003721904.1.102150 WP_003721904.1.10418 WP_003721904.1.10420 WP_003721904.1.10444 WP_003721904.1.10460 WP_003721904.1.10484 WP_003721904.1.11086 WP_003721904.1.11177 WP_003721904.1.1123 WP_003721904.1.11266 WP_003721904.1.11313 WP_003721904.1.11326 WP_003721904.1.11419 WP_003721904.1.1146 WP_003721904.1.1160 WP_003721904.1.11686 WP_003721904.1.11689 WP_003721904.1.11712 WP_003721904.1.11738 WP_003721904.1.11779 WP_003721904.1.11788 WP_003721904.1.11851 WP_003721904.1.11907 WP_003721904.1.11940 WP_003721904.1.11973 WP_003721904.1.11976 WP_003721904.1.12020 WP_003721904.1.12028 WP_003721904.1.12037 WP_003721904.1.12142 WP_003721904.1.12143 WP_003721904.1.12148 WP_003721904.1.12278 WP_003721904.1.12287 WP_003721904.1.12377 WP_003721904.1.12417 WP_003721904.1.12544 WP_003721904.1.12824 WP_003721904.1.12988 WP_003721904.1.12993 WP_003721904.1.13004 WP_003721904.1.13052 WP_003721904.1.13105 WP_003721904.1.13134 WP_003721904.1.13160 WP_003721904.1.13180 WP_003721904.1.13304 WP_003721904.1.13329 WP_003721904.1.1336 WP_003721904.1.13360 WP_003721904.1.13428 WP_003721904.1.13684 WP_003721904.1.13695 WP_003721904.1.137 WP_003721904.1.13779 WP_003721904.1.13833 WP_003721904.1.13847 WP_003721904.1.13855 WP_003721904.1.13921 WP_003721904.1.14103 WP_003721904.1.14339 WP_003721904.1.14636 WP_003721904.1.14641 WP_003721904.1.14832 WP_003721904.1.14875 WP_003721904.1.14895 WP_003721904.1.15085 WP_003721904.1.15122 WP_003721904.1.15342 WP_003721904.1.15495 WP_003721904.1.155 WP_003721904.1.15518 WP_003721904.1.1556 WP_003721904.1.15564 WP_003721904.1.15618 WP_003721904.1.15619 WP_003721904.1.15659 WP_003721904.1.1575 WP_003721904.1.1576 WP_003721904.1.15816 WP_003721904.1.15847 WP_003721904.1.16207 WP_003721904.1.16403 WP_003721904.1.16499 WP_003721904.1.16516 WP_003721904.1.1657 WP_003721904.1.16631 WP_003721904.1.16634 WP_003721904.1.1667 WP_003721904.1.16726 WP_003721904.1.16746 WP_003721904.1.1678 WP_003721904.1.1688 WP_003721904.1.17106 WP_003721904.1.17131 WP_003721904.1.17228 WP_003721904.1.17352 WP_003721904.1.17375 WP_003721904.1.17398 WP_003721904.1.17399 WP_003721904.1.17604 WP_003721904.1.1764 WP_003721904.1.17644 WP_003721904.1.17695 WP_003721904.1.17774 WP_003721904.1.178 WP_003721904.1.1794 WP_003721904.1.17947 WP_003721904.1.18026 WP_003721904.1.1803 WP_003721904.1.18046 WP_003721904.1.18222 WP_003721904.1.18289 WP_003721904.1.18463 WP_003721904.1.18576 WP_003721904.1.18648 WP_003721904.1.18677 WP_003721904.1.18689 WP_003721904.1.18721 WP_003721904.1.18833 WP_003721904.1.18979 WP_003721904.1.19080 WP_003721904.1.19112 WP_003721904.1.19167 WP_003721904.1.19189 WP_003721904.1.19195 WP_003721904.1.19246 WP_003721904.1.1929 WP_003721904.1.19371 WP_003721904.1.19372 WP_003721904.1.19409 WP_003721904.1.19443 WP_003721904.1.19452 WP_003721904.1.1947 WP_003721904.1.19472 WP_003721904.1.19542 WP_003721904.1.19548 WP_003721904.1.19549 WP_003721904.1.19584 WP_003721904.1.19607 WP_003721904.1.19615 WP_003721904.1.19685 WP_003721904.1.197 WP_003721904.1.19901 WP_003721904.1.20263 WP_003721904.1.20378 WP_003721904.1.20402 WP_003721904.1.20416 WP_003721904.1.20548 WP_003721904.1.20672 WP_003721904.1.21046 WP_003721904.1.21099 WP_003721904.1.21133 WP_003721904.1.21338 WP_003721904.1.21371 WP_003721904.1.21428 WP_003721904.1.21429 WP_003721904.1.21527 WP_003721904.1.21529 WP_003721904.1.21542 WP_003721904.1.21567 WP_003721904.1.21597 WP_003721904.1.21705 WP_003721904.1.21706 WP_003721904.1.21711 WP_003721904.1.21874 WP_003721904.1.21884 WP_003721904.1.21889 WP_003721904.1.21926 WP_003721904.1.21995 WP_003721904.1.22099 WP_003721904.1.22154 WP_003721904.1.22188 WP_003721904.1.22190 WP_003721904.1.22194 WP_003721904.1.22202 WP_003721904.1.22434 WP_003721904.1.22468 WP_003721904.1.22597 WP_003721904.1.22656 WP_003721904.1.22776 WP_003721904.1.22962 WP_003721904.1.23060 WP_003721904.1.23139 WP_003721904.1.23193 WP_003721904.1.23254 WP_003721904.1.23255 WP_003721904.1.23291 WP_003721904.1.233 WP_003721904.1.2340 WP_003721904.1.23425 WP_003721904.1.23433 WP_003721904.1.23448 WP_003721904.1.23582 WP_003721904.1.23624 WP_003721904.1.23650 WP_003721904.1.2368 WP_003721904.1.23781 WP_003721904.1.23828 WP_003721904.1.23848 WP_003721904.1.24048 WP_003721904.1.24075 WP_003721904.1.24115 WP_003721904.1.2422 WP_003721904.1.24335 WP_003721904.1.24349 WP_003721904.1.24370 WP_003721904.1.24411 WP_003721904.1.24422 WP_003721904.1.24531 WP_003721904.1.24546 WP_003721904.1.24600 WP_003721904.1.24651 WP_003721904.1.24667 WP_003721904.1.24818 WP_003721904.1.24836 WP_003721904.1.24847 WP_003721904.1.24867 WP_003721904.1.24934 WP_003721904.1.24945 WP_003721904.1.24972 WP_003721904.1.24975 WP_003721904.1.25020 WP_003721904.1.25057 WP_003721904.1.25300 WP_003721904.1.25401 WP_003721904.1.2545 WP_003721904.1.25456 WP_003721904.1.25471 WP_003721904.1.25500 WP_003721904.1.25616 WP_003721904.1.25746 WP_003721904.1.25805 WP_003721904.1.25830 WP_003721904.1.25896 WP_003721904.1.26052 WP_003721904.1.26060 WP_003721904.1.26103 WP_003721904.1.26139 WP_003721904.1.26145 WP_003721904.1.26170 WP_003721904.1.26320 WP_003721904.1.26322 WP_003721904.1.26350 WP_003721904.1.26406 WP_003721904.1.26523 WP_003721904.1.26632 WP_003721904.1.26634 WP_003721904.1.2666 WP_003721904.1.26891 WP_003721904.1.26957 WP_003721904.1.27056 WP_003721904.1.27132 WP_003721904.1.27143 WP_003721904.1.27200 WP_003721904.1.27231 WP_003721904.1.27281 WP_003721904.1.27517 WP_003721904.1.27669 WP_003721904.1.27681 WP_003721904.1.27728 WP_003721904.1.27826 WP_003721904.1.27839 WP_003721904.1.27860 WP_003721904.1.27891 WP_003721904.1.27948 WP_003721904.1.28042 WP_003721904.1.28060 WP_003721904.1.28062 WP_003721904.1.28098 WP_003721904.1.28123 WP_003721904.1.2824 WP_003721904.1.28260 WP_003721904.1.28297 WP_003721904.1.28325 WP_003721904.1.28369 WP_003721904.1.28402 WP_003721904.1.2855 WP_003721904.1.28722 WP_003721904.1.28747 WP_003721904.1.28792 WP_003721904.1.28803 WP_003721904.1.28804 WP_003721904.1.28818 WP_003721904.1.2920 WP_003721904.1.29309 WP_003721904.1.29331 WP_003721904.1.29550 WP_003721904.1.29558 WP_003721904.1.29562 WP_003721904.1.29565 WP_003721904.1.29569 WP_003721904.1.29634 WP_003721904.1.29705 WP_003721904.1.29723 WP_003721904.1.29738 WP_003721904.1.29762 WP_003721904.1.29803 WP_003721904.1.29872 WP_003721904.1.29912 WP_003721904.1.30124 WP_003721904.1.30193 WP_003721904.1.30227 WP_003721904.1.30267 WP_003721904.1.30273 WP_003721904.1.30372 WP_003721904.1.30430 WP_003721904.1.305 WP_003721904.1.30660 WP_003721904.1.30827 WP_003721904.1.30837 WP_003721904.1.30851 WP_003721904.1.30882 WP_003721904.1.30902 WP_003721904.1.3103 WP_003721904.1.31062 WP_003721904.1.31108 WP_003721904.1.31116 WP_003721904.1.31289 WP_003721904.1.31305 WP_003721904.1.31329 WP_003721904.1.31444 WP_003721904.1.31485 WP_003721904.1.31584 WP_003721904.1.31691 WP_003721904.1.31830 WP_003721904.1.31966 WP_003721904.1.3206 WP_003721904.1.32061 WP_003721904.1.32140 WP_003721904.1.32209 WP_003721904.1.32210 WP_003721904.1.32240 WP_003721904.1.32278 WP_003721904.1.32402 WP_003721904.1.32472 WP_003721904.1.32597 WP_003721904.1.32622 WP_003721904.1.32648 WP_003721904.1.32681 WP_003721904.1.32698 WP_003721904.1.32767 WP_003721904.1.32817 WP_003721904.1.33016 WP_003721904.1.3314 WP_003721904.1.3324 WP_003721904.1.33282 WP_003721904.1.33336 WP_003721904.1.33591 WP_003721904.1.33688 WP_003721904.1.337 WP_003721904.1.33875 WP_003721904.1.3393 WP_003721904.1.33995 WP_003721904.1.34326 WP_003721904.1.34369 WP_003721904.1.34698 WP_003721904.1.34714 WP_003721904.1.34732 WP_003721904.1.34790 WP_003721904.1.34849 WP_003721904.1.34851 WP_003721904.1.34911 WP_003721904.1.3511 WP_003721904.1.35135 WP_003721904.1.35350 WP_003721904.1.35402 WP_003721904.1.35450 WP_003721904.1.35452 WP_003721904.1.35514 WP_003721904.1.35738 WP_003721904.1.35979 WP_003721904.1.36108 WP_003721904.1.36115 WP_003721904.1.3613 WP_003721904.1.36181 WP_003721904.1.36203 WP_003721904.1.36241 WP_003721904.1.364 WP_003721904.1.36599 WP_003721904.1.36749 WP_003721904.1.36877 WP_003721904.1.36936 WP_003721904.1.37023 WP_003721904.1.37278 WP_003721904.1.37426 WP_003721904.1.37466 WP_003721904.1.37471 WP_003721904.1.37518 WP_003721904.1.37561 WP_003721904.1.37665 WP_003721904.1.37723 WP_003721904.1.3782 WP_003721904.1.37882 WP_003721904.1.37900 WP_003721904.1.37927 WP_003721904.1.37951 WP_003721904.1.37986 WP_003721904.1.38015 WP_003721904.1.38025 WP_003721904.1.38076 WP_003721904.1.38150 WP_003721904.1.38224 WP_003721904.1.38302 WP_003721904.1.38382 WP_003721904.1.38396 WP_003721904.1.384 WP_003721904.1.38424 WP_003721904.1.38471 WP_003721904.1.38528 WP_003721904.1.3853 WP_003721904.1.38575 WP_003721904.1.38733 WP_003721904.1.38741 WP_003721904.1.38792 WP_003721904.1.38800 WP_003721904.1.38819 WP_003721904.1.38833 WP_003721904.1.3892 WP_003721904.1.39000 WP_003721904.1.39115 WP_003721904.1.3919 WP_003721904.1.39218 WP_003721904.1.39262 WP_003721904.1.39307 WP_003721904.1.39316 WP_003721904.1.39348 WP_003721904.1.39351 WP_003721904.1.39427 WP_003721904.1.39496 WP_003721904.1.39554 WP_003721904.1.3959 WP_003721904.1.39630 WP_003721904.1.39794 WP_003721904.1.39871 WP_003721904.1.39887 WP_003721904.1.39895 WP_003721904.1.40124 WP_003721904.1.40245 WP_003721904.1.40263 WP_003721904.1.404 WP_003721904.1.40420 WP_003721904.1.405 WP_003721904.1.40556 WP_003721904.1.40580 WP_003721904.1.40720 WP_003721904.1.40820 WP_003721904.1.40841 WP_003721904.1.40953 WP_003721904.1.40976 WP_003721904.1.40978 WP_003721904.1.41023 WP_003721904.1.41222 WP_003721904.1.41281 WP_003721904.1.41337 WP_003721904.1.41348 WP_003721904.1.4166 WP_003721904.1.41700 WP_003721904.1.41876 WP_003721904.1.41903 WP_003721904.1.41909 WP_003721904.1.41955 WP_003721904.1.41970 WP_003721904.1.42010 WP_003721904.1.42040 WP_003721904.1.42089 WP_003721904.1.42127 WP_003721904.1.4218 WP_003721904.1.42310 WP_003721904.1.42317 WP_003721904.1.42339 WP_003721904.1.42525 WP_003721904.1.42550 WP_003721904.1.42564 WP_003721904.1.42615 WP_003721904.1.42672 WP_003721904.1.42926 WP_003721904.1.42958 WP_003721904.1.42994 WP_003721904.1.43060 WP_003721904.1.43135 WP_003721904.1.43267 WP_003721904.1.43280 WP_003721904.1.43304 WP_003721904.1.43327 WP_003721904.1.43336 WP_003721904.1.43350 WP_003721904.1.43458 WP_003721904.1.43480 WP_003721904.1.43619 WP_003721904.1.4371 WP_003721904.1.43768 WP_003721904.1.43807 WP_003721904.1.43916 WP_003721904.1.44023 WP_003721904.1.44092 WP_003721904.1.44106 WP_003721904.1.44161 WP_003721904.1.44230 WP_003721904.1.44427 WP_003721904.1.44596 WP_003721904.1.44645 WP_003721904.1.44663 WP_003721904.1.44703 WP_003721904.1.4472 WP_003721904.1.44749 WP_003721904.1.4479 WP_003721904.1.44806 WP_003721904.1.44897 WP_003721904.1.44924 WP_003721904.1.4503 WP_003721904.1.45295 WP_003721904.1.45309 WP_003721904.1.45355 WP_003721904.1.45512 WP_003721904.1.45524 WP_003721904.1.45541 WP_003721904.1.4562 WP_003721904.1.45708 WP_003721904.1.45719 WP_003721904.1.45758 WP_003721904.1.45778 WP_003721904.1.4578 WP_003721904.1.45811 WP_003721904.1.4587 WP_003721904.1.45877 WP_003721904.1.45883 WP_003721904.1.45893 WP_003721904.1.45983 WP_003721904.1.45994 WP_003721904.1.4604 WP_003721904.1.46045 WP_003721904.1.4615 WP_003721904.1.46154 WP_003721904.1.46180 WP_003721904.1.46277 WP_003721904.1.46314 WP_003721904.1.4642 WP_003721904.1.46425 WP_003721904.1.46456 WP_003721904.1.46566 WP_003721904.1.46653 WP_003721904.1.46711 WP_003721904.1.46725 WP_003721904.1.46834 WP_003721904.1.46863 WP_003721904.1.46867 WP_003721904.1.46883 WP_003721904.1.46981 WP_003721904.1.47001 WP_003721904.1.47055 WP_003721904.1.47075 WP_003721904.1.47384 WP_003721904.1.47412 WP_003721904.1.47431 WP_003721904.1.47518 WP_003721904.1.47520 WP_003721904.1.4753 WP_003721904.1.47593 WP_003721904.1.47650 WP_003721904.1.4766 WP_003721904.1.47738 WP_003721904.1.47759 WP_003721904.1.47952 WP_003721904.1.47953 WP_003721904.1.47979 WP_003721904.1.48007 WP_003721904.1.48161 WP_003721904.1.48163 WP_003721904.1.48175 WP_003721904.1.48180 WP_003721904.1.48235 WP_003721904.1.48358 WP_003721904.1.48410 WP_003721904.1.48435 WP_003721904.1.48440 WP_003721904.1.48441 WP_003721904.1.48471 WP_003721904.1.48565 WP_003721904.1.48572 WP_003721904.1.48624 WP_003721904.1.48661 WP_003721904.1.48854 WP_003721904.1.48999 WP_003721904.1.49 WP_003721904.1.49146 WP_003721904.1.49202 WP_003721904.1.49205 WP_003721904.1.49390 WP_003721904.1.49391 WP_003721904.1.49415 WP_003721904.1.49458 WP_003721904.1.49467 WP_003721904.1.49507 WP_003721904.1.49604 WP_003721904.1.49668 WP_003721904.1.49708 WP_003721904.1.4974 WP_003721904.1.49754 WP_003721904.1.49952 WP_003721904.1.49962 WP_003721904.1.50044 WP_003721904.1.50063 WP_003721904.1.50073 WP_003721904.1.5020 WP_003721904.1.50236 WP_003721904.1.50237 WP_003721904.1.50243 WP_003721904.1.50288 WP_003721904.1.50293 WP_003721904.1.50334 WP_003721904.1.50482 WP_003721904.1.50662 WP_003721904.1.50765 WP_003721904.1.50775 WP_003721904.1.50862 WP_003721904.1.50888 WP_003721904.1.50898 WP_003721904.1.50926 WP_003721904.1.50971 WP_003721904.1.51086 WP_003721904.1.51262 WP_003721904.1.5129 WP_003721904.1.51318 WP_003721904.1.51384 WP_003721904.1.51435 WP_003721904.1.51493 WP_003721904.1.51510 WP_003721904.1.51650 WP_003721904.1.5170 WP_003721904.1.51720 WP_003721904.1.51732 WP_003721904.1.5175 WP_003721904.1.51768 WP_003721904.1.51980 WP_003721904.1.52142 WP_003721904.1.52177 WP_003721904.1.52290 WP_003721904.1.52371 WP_003721904.1.52395 WP_003721904.1.52420 WP_003721904.1.52447 WP_003721904.1.52507 WP_003721904.1.52617 WP_003721904.1.52684 WP_003721904.1.52725 WP_003721904.1.52782 WP_003721904.1.52829 WP_003721904.1.52867 WP_003721904.1.52989 WP_003721904.1.53051 WP_003721904.1.53102 WP_003721904.1.53161 WP_003721904.1.5317 WP_003721904.1.53193 WP_003721904.1.53266 WP_003721904.1.53378 WP_003721904.1.53426 WP_003721904.1.53536 WP_003721904.1.53603 WP_003721904.1.53807 WP_003721904.1.53870 WP_003721904.1.53877 WP_003721904.1.53920 WP_003721904.1.54046 WP_003721904.1.54155 WP_003721904.1.54160 WP_003721904.1.5417 WP_003721904.1.54181 WP_003721904.1.54281 WP_003721904.1.54434 WP_003721904.1.54505 WP_003721904.1.54506 WP_003721904.1.54508 WP_003721904.1.54564 WP_003721904.1.54639 WP_003721904.1.54646 WP_003721904.1.54740 WP_003721904.1.54750 WP_003721904.1.54884 WP_003721904.1.54890 WP_003721904.1.55027 WP_003721904.1.55068 WP_003721904.1.5514 WP_003721904.1.55231 WP_003721904.1.55238 WP_003721904.1.5538 WP_003721904.1.55386 WP_003721904.1.55423 WP_003721904.1.55487 WP_003721904.1.55494 WP_003721904.1.55510 WP_003721904.1.55609 WP_003721904.1.55683 WP_003721904.1.55740 WP_003721904.1.55797 WP_003721904.1.55824 WP_003721904.1.55847 WP_003721904.1.55850 WP_003721904.1.55890 WP_003721904.1.5601 WP_003721904.1.56269 WP_003721904.1.56322 WP_003721904.1.56344 WP_003721904.1.56415 WP_003721904.1.56526 WP_003721904.1.56557 WP_003721904.1.56566 WP_003721904.1.5671 WP_003721904.1.56748 WP_003721904.1.56759 WP_003721904.1.5687 WP_003721904.1.56923 WP_003721904.1.57106 WP_003721904.1.57132 WP_003721904.1.57171 WP_003721904.1.57228 WP_003721904.1.57374 WP_003721904.1.57404 WP_003721904.1.57504 WP_003721904.1.57505 WP_003721904.1.57536 WP_003721904.1.57547 WP_003721904.1.57578 WP_003721904.1.57625 WP_003721904.1.57766 WP_003721904.1.57913 WP_003721904.1.57932 WP_003721904.1.57948 WP_003721904.1.57963 WP_003721904.1.57979 WP_003721904.1.58 WP_003721904.1.58030 WP_003721904.1.58069 WP_003721904.1.58083 WP_003721904.1.58088 WP_003721904.1.58177 WP_003721904.1.58491 WP_003721904.1.58516 WP_003721904.1.58532 WP_003721904.1.58544 WP_003721904.1.58661 WP_003721904.1.58828 WP_003721904.1.58966 WP_003721904.1.59045 WP_003721904.1.59113 WP_003721904.1.59343 WP_003721904.1.59353 WP_003721904.1.59477 WP_003721904.1.59493 WP_003721904.1.59542 WP_003721904.1.59571 WP_003721904.1.59652 WP_003721904.1.59695 WP_003721904.1.59720 WP_003721904.1.5973 WP_003721904.1.59744 WP_003721904.1.59799 WP_003721904.1.59826 WP_003721904.1.59937 WP_003721904.1.59949 WP_003721904.1.59975 WP_003721904.1.59984 WP_003721904.1.60132 WP_003721904.1.60162 WP_003721904.1.60166 WP_003721904.1.60191 WP_003721904.1.60219 WP_003721904.1.60258 WP_003721904.1.60295 WP_003721904.1.60346 WP_003721904.1.60369 WP_003721904.1.60543 WP_003721904.1.60665 WP_003721904.1.60674 WP_003721904.1.60762 WP_003721904.1.60766 WP_003721904.1.60768 WP_003721904.1.60956 WP_003721904.1.61002 WP_003721904.1.61072 WP_003721904.1.611 WP_003721904.1.61109 WP_003721904.1.61244 WP_003721904.1.61274 WP_003721904.1.61358 WP_003721904.1.61371 WP_003721904.1.61384 WP_003721904.1.61525 WP_003721904.1.61824 WP_003721904.1.61894 WP_003721904.1.61915 WP_003721904.1.62177 WP_003721904.1.6236 WP_003721904.1.62375 WP_003721904.1.62430 WP_003721904.1.62494 WP_003721904.1.62573 WP_003721904.1.62629 WP_003721904.1.62655 WP_003721904.1.62663 WP_003721904.1.62690 WP_003721904.1.6281 WP_003721904.1.62852 WP_003721904.1.62874 WP_003721904.1.62904 WP_003721904.1.62972 WP_003721904.1.63209 WP_003721904.1.63269 WP_003721904.1.63283 WP_003721904.1.63315 WP_003721904.1.63359 WP_003721904.1.63605 WP_003721904.1.63676 WP_003721904.1.63842 WP_003721904.1.63883 WP_003721904.1.63951 WP_003721904.1.6397 WP_003721904.1.64041 WP_003721904.1.64147 WP_003721904.1.64200 WP_003721904.1.64227 WP_003721904.1.64259 WP_003721904.1.64289 WP_003721904.1.64413 WP_003721904.1.64587 WP_003721904.1.6460 WP_003721904.1.64796 WP_003721904.1.648 WP_003721904.1.64869 WP_003721904.1.64929 WP_003721904.1.65094 WP_003721904.1.65143 WP_003721904.1.65213 WP_003721904.1.65309 WP_003721904.1.65376 WP_003721904.1.65392 WP_003721904.1.65561 WP_003721904.1.65780 WP_003721904.1.6579 WP_003721904.1.65827 WP_003721904.1.65840 WP_003721904.1.65913 WP_003721904.1.66005 WP_003721904.1.66039 WP_003721904.1.66057 WP_003721904.1.66134 WP_003721904.1.66138 WP_003721904.1.66184 WP_003721904.1.66285 WP_003721904.1.66311 WP_003721904.1.66338 WP_003721904.1.66510 WP_003721904.1.66512 WP_003721904.1.66545 WP_003721904.1.66596 WP_003721904.1.6672 WP_003721904.1.66743 WP_003721904.1.66884 WP_003721904.1.66903 WP_003721904.1.66993 WP_003721904.1.67165 WP_003721904.1.67301 WP_003721904.1.6731 WP_003721904.1.67352 WP_003721904.1.67408 WP_003721904.1.67429 WP_003721904.1.6745 WP_003721904.1.67551 WP_003721904.1.67573 WP_003721904.1.67610 WP_003721904.1.6763 WP_003721904.1.67654 WP_003721904.1.67668 WP_003721904.1.67694 WP_003721904.1.67709 WP_003721904.1.67795 WP_003721904.1.67813 WP_003721904.1.67884 WP_003721904.1.67926 WP_003721904.1.68112 WP_003721904.1.68123 WP_003721904.1.68128 WP_003721904.1.68197 WP_003721904.1.68208 WP_003721904.1.68236 WP_003721904.1.68282 WP_003721904.1.68301 WP_003721904.1.68321 WP_003721904.1.68414 WP_003721904.1.68497 WP_003721904.1.68517 WP_003721904.1.68525 WP_003721904.1.68528 WP_003721904.1.68740 WP_003721904.1.69190 WP_003721904.1.69263 WP_003721904.1.69265 WP_003721904.1.69360 WP_003721904.1.69471 WP_003721904.1.69570 WP_003721904.1.69579 WP_003721904.1.69603 WP_003721904.1.69631 WP_003721904.1.69727 WP_003721904.1.6982 WP_003721904.1.69864 WP_003721904.1.6991 WP_003721904.1.69989 WP_003721904.1.70100 WP_003721904.1.70104 WP_003721904.1.70122 WP_003721904.1.7026 WP_003721904.1.70309 WP_003721904.1.70373 WP_003721904.1.7051 WP_003721904.1.70588 WP_003721904.1.70590 WP_003721904.1.70633 WP_003721904.1.70690 WP_003721904.1.70736 WP_003721904.1.70992 WP_003721904.1.71381 WP_003721904.1.71437 WP_003721904.1.71468 WP_003721904.1.71474 WP_003721904.1.71726 WP_003721904.1.7175 WP_003721904.1.71753 WP_003721904.1.71763 WP_003721904.1.71858 WP_003721904.1.71904 WP_003721904.1.71921 WP_003721904.1.72051 WP_003721904.1.72057 WP_003721904.1.72116 WP_003721904.1.7218 WP_003721904.1.72228 WP_003721904.1.72264 WP_003721904.1.72370 WP_003721904.1.72385 WP_003721904.1.72467 WP_003721904.1.72546 WP_003721904.1.72558 WP_003721904.1.72566 WP_003721904.1.72623 WP_003721904.1.72636 WP_003721904.1.72813 WP_003721904.1.72841 WP_003721904.1.72886 WP_003721904.1.72918 WP_003721904.1.73152 WP_003721904.1.73263 WP_003721904.1.734 WP_003721904.1.73448 WP_003721904.1.73508 WP_003721904.1.73545 WP_003721904.1.73613 WP_003721904.1.73656 WP_003721904.1.73769 WP_003721904.1.74095 WP_003721904.1.74148 WP_003721904.1.7421 WP_003721904.1.74217 WP_003721904.1.74290 WP_003721904.1.74351 WP_003721904.1.74436 WP_003721904.1.74450 WP_003721904.1.7454 WP_003721904.1.74572 WP_003721904.1.74617 WP_003721904.1.74728 WP_003721904.1.74754 WP_003721904.1.74823 WP_003721904.1.74837 WP_003721904.1.74927 WP_003721904.1.74956 WP_003721904.1.7498 WP_003721904.1.7504 WP_003721904.1.75069 WP_003721904.1.75072 WP_003721904.1.75216 WP_003721904.1.75240 WP_003721904.1.7528 WP_003721904.1.7553 WP_003721904.1.75541 WP_003721904.1.75548 WP_003721904.1.75604 WP_003721904.1.75624 WP_003721904.1.7565 WP_003721904.1.75670 WP_003721904.1.75838 WP_003721904.1.75869 WP_003721904.1.75923 WP_003721904.1.76094 WP_003721904.1.76124 WP_003721904.1.76168 WP_003721904.1.76247 WP_003721904.1.76254 WP_003721904.1.76367 WP_003721904.1.76545 WP_003721904.1.76608 WP_003721904.1.76769 WP_003721904.1.76926 WP_003721904.1.76982 WP_003721904.1.77116 WP_003721904.1.77149 WP_003721904.1.77191 WP_003721904.1.77222 WP_003721904.1.77246 WP_003721904.1.77261 WP_003721904.1.77345 WP_003721904.1.77350 WP_003721904.1.7736 WP_003721904.1.77376 WP_003721904.1.7738 WP_003721904.1.77389 WP_003721904.1.77420 WP_003721904.1.77594 WP_003721904.1.77675 WP_003721904.1.77681 WP_003721904.1.77697 WP_003721904.1.77823 WP_003721904.1.77849 WP_003721904.1.77928 WP_003721904.1.77943 WP_003721904.1.78088 WP_003721904.1.78121 WP_003721904.1.78130 WP_003721904.1.78167 WP_003721904.1.78203 WP_003721904.1.78315 WP_003721904.1.7832 WP_003721904.1.78328 WP_003721904.1.78336 WP_003721904.1.78525 WP_003721904.1.78681 WP_003721904.1.78717 WP_003721904.1.79128 WP_003721904.1.79149 WP_003721904.1.79184 WP_003721904.1.79212 WP_003721904.1.79259 WP_003721904.1.7932 WP_003721904.1.79351 WP_003721904.1.79434 WP_003721904.1.79458 WP_003721904.1.79602 WP_003721904.1.79630 WP_003721904.1.79803 WP_003721904.1.79821 WP_003721904.1.79964 WP_003721904.1.80028 WP_003721904.1.80036 WP_003721904.1.80088 WP_003721904.1.80105 WP_003721904.1.80514 WP_003721904.1.80693 WP_003721904.1.80790 WP_003721904.1.80968 WP_003721904.1.81140 WP_003721904.1.81261 WP_003721904.1.81270 WP_003721904.1.81315 WP_003721904.1.81476 WP_003721904.1.81495 WP_003721904.1.81503 WP_003721904.1.8151 WP_003721904.1.81647 WP_003721904.1.81662 WP_003721904.1.81713 WP_003721904.1.81863 WP_003721904.1.82274 WP_003721904.1.82294 WP_003721904.1.82372 WP_003721904.1.82440 WP_003721904.1.82480 WP_003721904.1.82605 WP_003721904.1.82662 WP_003721904.1.82667 WP_003721904.1.82719 WP_003721904.1.82821 WP_003721904.1.82893 WP_003721904.1.82951 WP_003721904.1.82974 WP_003721904.1.83015 WP_003721904.1.83030 WP_003721904.1.83121 WP_003721904.1.83130 WP_003721904.1.83137 WP_003721904.1.83215 WP_003721904.1.83217 WP_003721904.1.83260 WP_003721904.1.83323 WP_003721904.1.83350 WP_003721904.1.83478 WP_003721904.1.83542 WP_003721904.1.83546 WP_003721904.1.83607 WP_003721904.1.83755 WP_003721904.1.83809 WP_003721904.1.83877 WP_003721904.1.83907 WP_003721904.1.8391 WP_003721904.1.83932 WP_003721904.1.8418 WP_003721904.1.84180 WP_003721904.1.84265 WP_003721904.1.84320 WP_003721904.1.84367 WP_003721904.1.84539 WP_003721904.1.84579 WP_003721904.1.84586 WP_003721904.1.84588 WP_003721904.1.8460 WP_003721904.1.8465 WP_003721904.1.8473 WP_003721904.1.84781 WP_003721904.1.84833 WP_003721904.1.84895 WP_003721904.1.84974 WP_003721904.1.84980 WP_003721904.1.85036 WP_003721904.1.85037 WP_003721904.1.85172 WP_003721904.1.85194 WP_003721904.1.85203 WP_003721904.1.85317 WP_003721904.1.85321 WP_003721904.1.8539 WP_003721904.1.85576 WP_003721904.1.85690 WP_003721904.1.85890 WP_003721904.1.8593 WP_003721904.1.86056 WP_003721904.1.86091 WP_003721904.1.86098 WP_003721904.1.86232 WP_003721904.1.86253 WP_003721904.1.86308 WP_003721904.1.86484 WP_003721904.1.86571 WP_003721904.1.86597 WP_003721904.1.866 WP_003721904.1.86683 WP_003721904.1.86752 WP_003721904.1.86958 WP_003721904.1.87085 WP_003721904.1.8710 WP_003721904.1.87101 WP_003721904.1.87108 WP_003721904.1.8715 WP_003721904.1.87154 WP_003721904.1.87179 WP_003721904.1.87294 WP_003721904.1.87328 WP_003721904.1.87329 WP_003721904.1.87436 WP_003721904.1.87536 WP_003721904.1.87537 WP_003721904.1.87701 WP_003721904.1.87794 WP_003721904.1.8782 WP_003721904.1.87890 WP_003721904.1.87903 WP_003721904.1.87920 WP_003721904.1.88015 WP_003721904.1.88055 WP_003721904.1.88063 WP_003721904.1.88112 WP_003721904.1.88128 WP_003721904.1.88211 WP_003721904.1.88397 WP_003721904.1.88422 WP_003721904.1.88463 WP_003721904.1.88485 WP_003721904.1.88584 WP_003721904.1.88589 WP_003721904.1.88639 WP_003721904.1.88768 WP_003721904.1.88783 WP_003721904.1.88800 WP_003721904.1.88806 WP_003721904.1.8884 WP_003721904.1.88877 WP_003721904.1.88890 WP_003721904.1.88895 WP_003721904.1.88974 WP_003721904.1.89014 WP_003721904.1.89085 WP_003721904.1.89160 WP_003721904.1.89267 WP_003721904.1.89302 WP_003721904.1.8932 WP_003721904.1.89386 WP_003721904.1.89387 WP_003721904.1.89443 WP_003721904.1.89450 WP_003721904.1.89478 WP_003721904.1.89505 WP_003721904.1.89756 WP_003721904.1.89809 WP_003721904.1.89812 WP_003721904.1.8988 WP_003721904.1.89897 WP_003721904.1.89916 WP_003721904.1.89969 WP_003721904.1.90086 WP_003721904.1.9019 WP_003721904.1.90201 WP_003721904.1.90212 WP_003721904.1.90326 WP_003721904.1.90459 WP_003721904.1.90524 WP_003721904.1.90567 WP_003721904.1.90646 WP_003721904.1.90741 WP_003721904.1.90772 WP_003721904.1.90821 WP_003721904.1.90829 WP_003721904.1.90857 WP_003721904.1.90963 WP_003721904.1.91084 WP_003721904.1.9109 WP_003721904.1.91140 WP_003721904.1.91168 WP_003721904.1.91195 WP_003721904.1.91443 WP_003721904.1.91514 WP_003721904.1.91556 WP_003721904.1.91560 WP_003721904.1.91765 WP_003721904.1.91920 WP_003721904.1.91922 WP_003721904.1.92049 WP_003721904.1.92132 WP_003721904.1.92142 WP_003721904.1.92148 WP_003721904.1.92274 WP_003721904.1.92288 WP_003721904.1.92370 WP_003721904.1.92409 WP_003721904.1.9243 WP_003721904.1.92494 WP_003721904.1.92548 WP_003721904.1.92591 WP_003721904.1.92595 WP_003721904.1.9282 WP_003721904.1.92928 WP_003721904.1.92963 WP_003721904.1.93014 WP_003721904.1.93049 WP_003721904.1.93217 WP_003721904.1.93325 WP_003721904.1.93421 WP_003721904.1.93490 WP_003721904.1.93534 WP_003721904.1.93556 WP_003721904.1.93558 WP_003721904.1.93611 WP_003721904.1.93712 WP_003721904.1.93777 WP_003721904.1.93859 WP_003721904.1.93867 WP_003721904.1.93895 WP_003721904.1.93920 WP_003721904.1.93997 WP_003721904.1.94026 WP_003721904.1.94032 WP_003721904.1.94058 WP_003721904.1.94059 WP_003721904.1.94081 WP_003721904.1.94191 WP_003721904.1.94206 WP_003721904.1.94225 WP_003721904.1.94233 WP_003721904.1.94336 WP_003721904.1.94401 WP_003721904.1.94431 WP_003721904.1.94447 WP_003721904.1.94464 WP_003721904.1.94499 WP_003721904.1.94537 WP_003721904.1.94554 WP_003721904.1.94613 WP_003721904.1.9470 WP_003721904.1.94758 WP_003721904.1.94759 WP_003721904.1.94795 WP_003721904.1.94906 WP_003721904.1.94961 WP_003721904.1.9502 WP_003721904.1.95100 WP_003721904.1.95146 WP_003721904.1.95162 WP_003721904.1.9517 WP_003721904.1.95186 WP_003721904.1.95197 WP_003721904.1.95696 WP_003721904.1.95702 WP_003721904.1.95715 WP_003721904.1.95945 WP_003721904.1.96033 WP_003721904.1.96084 WP_003721904.1.96140 WP_003721904.1.96156 WP_003721904.1.96296 WP_003721904.1.96407 WP_003721904.1.96422 WP_003721904.1.9643 WP_003721904.1.96438 WP_003721904.1.96449 WP_003721904.1.96496 WP_003721904.1.96542 WP_003721904.1.96544 WP_003721904.1.96586 WP_003721904.1.96596 WP_003721904.1.96605 WP_003721904.1.96708 WP_003721904.1.9672 WP_003721904.1.96751 WP_003721904.1.96835 WP_003721904.1.96867 WP_003721904.1.96874 WP_003721904.1.96940 WP_003721904.1.97140 WP_003721904.1.97165 WP_003721904.1.97199 WP_003721904.1.97203 WP_003721904.1.9732 WP_003721904.1.97378 WP_003721904.1.97390 WP_003721904.1.97469 WP_003721904.1.97569 WP_003721904.1.97587 WP_003721904.1.97589 WP_003721904.1.97633 WP_003721904.1.9768 WP_003721904.1.9769 WP_003721904.1.97752 WP_003721904.1.97803 WP_003721904.1.97820 WP_003721904.1.97900 WP_003721904.1.97970 WP_003721904.1.9802 WP_003721904.1.98038 WP_003721904.1.98042 WP_003721904.1.98060 WP_003721904.1.98193 WP_003721904.1.98331 WP_003721904.1.98351 WP_003721904.1.98490 WP_003721904.1.98689 WP_003721904.1.98826 WP_003721904.1.98829 WP_003721904.1.98866 WP_003721904.1.9894 WP_003721904.1.98974 WP_003721904.1.99026 WP_003721904.1.9916 WP_003721904.1.99199 WP_003721904.1.99357 WP_003721904.1.99409 WP_003721904.1.99480 WP_003721904.1.99512 WP_003721904.1.99518 WP_003721904.1.99520 WP_003721904.1.99521 WP_003721904.1.99527 WP_003721904.1.99553 WP_003721904.1.99568 WP_003721904.1.99663 WP_003721904.1.99702 WP_003721904.1.99737 WP_003721904.1.99785 WP_003721904.1.99786 WP_003721904.1.99818 WP_003721904.1.99836 WP_003721904.1.99906 WP_003721904.1.99914 WP_003721904.1.99921 WP_003721904.1.99974 gi|525723402|ref|YP_008288135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]