SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266117.Rxyl_0696 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266117.Rxyl_0696
Domain Number 1 Region: 175-294
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.85e-34
Family NlpC/P60 0.0058
Further Details:      
 
Weak hits

Sequence:  266117.Rxyl_0696
Domain Number - Region: 75-147
Classification Level Classification E-value
Superfamily TNF-like 0.00715
Family TNF-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266117.Rxyl_0696
Sequence length 300
Comment (Rubrobacter xylanophilus DSM 9941)
Sequence
MFRTGLVLAALSLSAALAALGLSGRAALADAYSQVVDNSTRGRFEAPGWGTSSWNDGRYG
KDYRYARPAREARPARYRVKIPATGYYTVYARWPADRGYNAGTRIGVSAAGGLRWVRVDQ
QRNGDRWNRLGVFRMKAGDRFYIRVSRRAGGGKYVIADAVKVVRGRVGGSGGSGITGYDI
LEEARSWLGVPYKYGGESREGVDCSGLTMKVYERFGIELPRTAHDQYYSGPGRKVSRSEL
RRGYLVFGHADGGSGIEHVGILTGDGRMIHAPAPGTVVRYDDVPARWYNIVGVKRIVPPR
Download sequence
Identical sequences Q1AY62
266117.Rxyl_0696 gi|108803541|ref|YP_643478.1| WP_011563684.1.70533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]