SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266117.Rxyl_0786 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266117.Rxyl_0786
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.14e-32
Family Chaperone J-domain 0.00019
Further Details:      
 
Domain Number 2 Region: 261-350
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 4.58e-21
Family HSP40/DnaJ peptide-binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 137-213
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 5.89e-18
Family DnaJ/Hsp40 cysteine-rich domain 0.00017
Further Details:      
 
Domain Number 4 Region: 117-175,217-260
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.53e-17
Family HSP40/DnaJ peptide-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266117.Rxyl_0786
Sequence length 373
Comment (Rubrobacter xylanophilus DSM 9941)
Sequence
MQTKDLYKVLGVDRGASQEEIRRAYRKLARRYHPDANPGDKEAEERFKEIQHAYEILSDP
QKRREYDEGPRTFFEGARQGTGGFRPGGFSDLSDLFEGFGGLGDIFGRAGRRGDAGPRRG
EDVTVSVNLRFKDALEGVTTRVSVPVEAVCEACRGTGAAPGTVPRRCPRCDGRGMRSRDQ
GLFAFSEPCSACGGRGTVIDSPCSACGGGGRVRMNRRVTVRVPPGARDGMKIRVPGRGSA
GRDGGPPGDLYVVTRVEEHPVFKRRGDDFVVEVPVSFVEAALGAEIEVPRPEGGRLRLRL
PAGTQEGRQFRVRGAGAPKARSRSGERGDLIVRAHVVVPQKLRRREREILEAFAEERGED
VREELFKRAGSWT
Download sequence
Identical sequences Q1AXX4
266117.Rxyl_0786 gi|108803629|ref|YP_643566.1| WP_011563772.1.70533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]