SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266117.Rxyl_1339 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266117.Rxyl_1339
Domain Number 1 Region: 12-187
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 6.55e-45
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266117.Rxyl_1339
Sequence length 192
Comment (Rubrobacter xylanophilus DSM 9941)
Sequence
MVEIERVAVSFDGFEVNSYVVHAPQGELVVDAGAEPERILGRLRGEAVAILITHGHADHI
GALEEVRRATGAPVYMHPADAEPAGVAGYDPLEDGRLLELGGAALRVLHTPGHSPGSVTF
VLGEDQLVGDLILPGSVGRTDIPGASWEEIELSLRRVMPLWSERTRLYCGHGPVLSAAEE
RAKNPYLPPEVA
Download sequence
Identical sequences Q1AWC5
gi|108804178|ref|YP_644115.1| WP_011564320.1.70533 266117.Rxyl_1339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]