SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266117.Rxyl_1418 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266117.Rxyl_1418
Domain Number 1 Region: 4-140
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.71e-45
Family Ribonuclease PH domain 1-like 0.0000177
Further Details:      
 
Domain Number 2 Region: 283-479
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.73e-44
Family Ribonuclease PH domain 1-like 0.00000562
Further Details:      
 
Domain Number 3 Region: 442-541
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.3e-29
Family Ribonuclease PH domain 2-like 0.0000843
Further Details:      
 
Domain Number 4 Region: 141-231
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.01e-26
Family Ribonuclease PH domain 2-like 0.0012
Further Details:      
 
Domain Number 5 Region: 547-632
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.39e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 6 Region: 611-684
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.49e-16
Family Cold shock DNA-binding domain-like 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266117.Rxyl_1418
Sequence length 686
Comment (Rubrobacter xylanophilus DSM 9941)
Sequence
MRLEIPVGERAIVLETGKLARQAGGAVTARFGDTTVLSTATRSEEPRPGATFLPLSVDIE
ERMSSAGKIPGGFLKREGKPSEKAILTARLTDRPIRPLFPKDYYYEVQVIGTVLVADQEN
PYDVVSMVGASAALALSDIPFGGPIGAVRVGRHPDGGFILNPTYQQLEESDLDIVVAGTK
EAITMVEAGAREVTEDVVVEALEVAQGVIREQAEAIERWAAEHGEEKQPFEEPGENPFVE
ELRGAYLERIKEGLISTDRRARHEAIDLLKEELVEGRSEEEVPLVLDALAQLQKEAFRKL
YLEDRKRTDLRAFDEIRPTTAEAHVLPRVHGTGLFTRGETQVLSSLALADLGLVQRLDTL
EPQTTKRYMHHYYFPPYSTGETGRLGPPRRREIGHGALAERALLPVIPSEEEFPYAIRII
SEVLESNGSSSMASVCGSTLALMDGGVPIKAPVAGVAMGLVKEGDDYVILTDIQGLEDHM
GDMDFKVAGTRDGITALQMDMKITGVSAELLKEALEQARRGRLQILDIMREEIAEPRPEI
SDHAPRVEVIQIPTDKIGLLIGPGGKTINALQDEYGVNISVENDGTVYVAGVEGMSVKAA
VSAIKGMTKEVEAGDIYVGKVVKTTNFGAFVELTPGRDGLLHISRLAPGKQRVRRVEDVL
NEGDVVKVRVLEIDKQNRISLEMVED
Download sequence
Identical sequences Q1AW48
266117.Rxyl_1418 gi|108804255|ref|YP_644192.1| WP_011564397.1.70533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]