SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266117.Rxyl_1425 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266117.Rxyl_1425
Domain Number 1 Region: 319-464
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.57e-27
Family HD domain 0.019
Further Details:      
 
Domain Number 2 Region: 202-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000665
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 
Weak hits

Sequence:  266117.Rxyl_1425
Domain Number - Region: 31-84
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.000549
Family F1F0 ATP synthase subunit B, membrane domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266117.Rxyl_1425
Sequence length 514
Comment (Rubrobacter xylanophilus DSM 9941)
Sequence
MSVLWMVLGLAIGIAVGAAAGYIVCRSRTDRRLAETRADARSIIEDANRQAETLRREAEL
AAKEAAMRIKDEAEAEVRARRAEISRIEERLDNRDTALDRREVELDERRRRLSETEDELR
RREESLAEREQEQLRALEEISGLSRAEAEERLFSRVEAELERRIGRMVRNRISEAEENAD
LEARRILATTMERLASDLTSESTVKAVELPSDDMKGRVIGREGRNIRAFEAATGVDVIID
DTPETVVLSCFDPVRREVARIAMERLVKDGRIHPGRIEQVVAKVRKEVEKEMKAAGRQAL
YDAKVSGSMHGDLLRLLGALKYRSSYGQNVLAHSVEVANIAGMMAQELGANVKIARRAAL
LHDVGKAIDHEAEGTHALIGGRFAKKCGESDEVVRAISAHHHEVEMQTVEDVIVATADAV
SAARPGARRETTEVYLERLRNLEDIALSHRGVDKAYAIQAGREIRVMVQPSEVDDRIAAK
LAYDISRKIEDELEYPGQIKVTVIRESRVSEVAR
Download sequence
Identical sequences Q1AW41
WP_011564404.1.70533 266117.Rxyl_1425 gi|108804262|ref|YP_644199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]