SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266117.Rxyl_1924 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266117.Rxyl_1924
Domain Number 1 Region: 11-126
Classification Level Classification E-value
Superfamily PIN domain-like 0.000000157
Family PIN domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266117.Rxyl_1924
Sequence length 137
Comment (Rubrobacter xylanophilus DSM 9941)
Sequence
MTHPRPQRAREAALWLVGLIDAGVLVRVPEIADYEVRRELLRADKTEGVARLVRLAGEIG
YLPLCTEAMRLAARFWADARKRGQPTAPDESIDADVILAAQAILAEDGGANTVEVATTNP
RHLSRFVNARSWQEIRA
Download sequence
Identical sequences Q1AUQ7
266117.Rxyl_1924 gi|108804746|ref|YP_644683.1| WP_011564886.1.70533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]