SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266264.Rmet_0931 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266264.Rmet_0931
Domain Number 1 Region: 5-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.34e-52
Family NQO2-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266264.Rmet_0931
Sequence length 168
Comment (Ralstonia metallidurans CH34)
Sequence
MTMLSAEALKEIDRAIAKYPADQKQSAVMAALAVAQGEVGWVSPEVMQFVASYLEMPPVW
VEEVATFYNMYDTKPVGKHKLAVCTNLPCALSGGERAGEYLKRKLGIDYNETTADGCFTL
KEGECMGACGDAPVMIVNNTRMCSFMSEQKIDALVEELKSEAAAKGDK
Download sequence
Identical sequences A0A132HIX5 Q1LPV9
266264.Rmet_0931 gi|94309876|ref|YP_583086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]