SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266264.Rmet_2465 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266264.Rmet_2465
Domain Number 1 Region: 1-250
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.6e-90
Family Tryptophan biosynthesis enzymes 0.00000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266264.Rmet_2465
Sequence length 265
Comment (Ralstonia metallidurans CH34)
Sequence
MSRIQKTFAALAAQQKKGLIPFITAGDPAPALTVDLMHALVAGGADVIELGVPFSDPMAD
GPVIQRASERALAQGVSLTQVLAWVTEFRKTNATTPVVLMGYANPIERMGEETFAKAASA
AGVDGVLVVDYPPEECESFAALMRANQMDPIFLLAPTSTDDRIAAVAKVASGYLYYVSLT
GVTGSATLDLESVAARLPLIKQHANLPVGVGFGIRDAQTARAIGSVADAVVIGSRLVQLL
EDAPREKAVDSLRAFIADIRQALDA
Download sequence
Identical sequences Q1LKI4
266264.Rmet_2465 WP_011517055.1.12480 WP_011517055.1.22474 WP_011517055.1.25839 WP_011517055.1.38154 gi|94311401|ref|YP_584611.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]