SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266264.Rmet_2823 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  266264.Rmet_2823
Domain Number - Region: 21-44
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00667
Family Rad50 coiled-coil Zn hook 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266264.Rmet_2823
Sequence length 120
Comment (Ralstonia metallidurans CH34)
Sequence
MVVKRRLREGRDGQLGPPPEAPTATGSLCPLCGRRLLDDATTDLHHPVPRSHGGRAVVPM
HRVCHQKIHSVFTEAELATTYHDWNALRAHPAIADFIRWIARKPPGFYDRSRATNARRGR
Download sequence
Identical sequences Q1LJI0
266264.Rmet_2823 WP_011517389.1.12480 WP_011517389.1.25839 gi|94311755|ref|YP_584965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]