SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266264.Rmet_5959 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266264.Rmet_5959
Domain Number 1 Region: 17-165
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 1.94e-19
Family Lambda integrase-like, catalytic core 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266264.Rmet_5959
Sequence length 173
Comment (Ralstonia metallidurans CH34)
Sequence
MRTIANGLEWSYGWQAAAAQRLRFLLDFGYATGLRISELANAALRHLDVDAAGDHWLHLV
GKGGKPARVTLTPLARTALERHLLERGLPVSLARWNPPKPIVGSLDGGETGITPLRLWEV
MHRFFRLAANTIEGDHPALAEKLRRAIRQWMRHSHATHALAKGVERKRPVNPS
Download sequence
Identical sequences A0A132H989 Q58AK7
gi|56130708|ref|YP_145611.1|NC_006466 266264.Rmet_5959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]