SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266265.Bxe_B0948 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266265.Bxe_B0948
Domain Number 1 Region: 31-133
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.32e-17
Family MarR-like transcriptional regulators 0.015
Further Details:      
 
Weak hits

Sequence:  266265.Bxe_B0948
Domain Number - Region: 134-166
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0607
Family Short-chain ferredoxins 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266265.Bxe_B0948
Sequence length 177
Comment (Burkholderia xenovorans LB400)
Sequence
MTQRTENLLGVLALLVTDEMNAQPTVDALAGPTARAMLNAVGQYPDSSIEVLREAVDLSH
PAAVRAVAGLVEAGLVEKKSGADKRAVALALTAAGKREAKRLQTARDRMLQRIVGRLDGS
EREVLESLLIKILWNETRDPAHAMQLCRLCDDGPCLKAGCPVECREQGLPMPARSRS
Download sequence
Identical sequences Q13LN3
266265.Bxe_B0948 gi|91779148|ref|YP_554356.1| WP_011492310.1.38508 WP_011492310.1.45576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]