SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266265.Bxe_C0251 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266265.Bxe_C0251
Domain Number 1 Region: 3-198
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.12e-50
Family ETFP subunits 0.00000779
Further Details:      
 
Domain Number 2 Region: 202-322
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.92e-46
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.00000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266265.Bxe_C0251
Sequence length 327
Comment (Burkholderia xenovorans LB400)
Sequence
MTILVIAEHDAPKEAPLGGNASLKAATLNTVAAAAVIATLAAHDIHVLVAGHNAQGAAEE
AAKIAGVTKVLLADAPQLEAGLAENVAATVLNIAKDYSHILAPATAYGKNIAPRIAAKLD
VAQISDITAVDSADTFERPIYAGNAIATVQSQDPIKVITVRTTGFDAVAAEGGSATVGKI
EAAADAGVSQFVSREVTKLDRPELTSAKIIVSGGRGLGNGENYTKVLEPLADRLNAALGA
SRAAVDAGFVPNDYQVGQTGKIVAPQLYIAVGISGAIQHLAGMKDSKVIVAINKDEEAPI
FSVADYGVVGDLFTVVPEFASQLAQLD
Download sequence
Identical sequences Q13IB4
gi|91780318|ref|YP_555525.1| 266265.Bxe_C0251 WP_011493435.1.38508 WP_011493435.1.45576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]