SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266779.Meso_0445 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266779.Meso_0445
Domain Number 1 Region: 4-97
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.00000539
Family Dual specificity phosphatase-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266779.Meso_0445
Sequence length 111
Comment (Mesorhizobium BNC1)
Sequence
MEIRSVNEDFAVAGQIAPGNVAEIASAGFKSIVCNRPDTEDGAVPHDAVEEAARAAGLEF
RFLPVVSGAITQEDVKGMAAILGELPHPVLAYCRSGTRCLNLYGLVQQIKG
Download sequence
Identical sequences Q11L76
266779.Meso_0445 WP_011579792.1.76240 gi|110632806|ref|YP_673014.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]