SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266779.Meso_0648 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266779.Meso_0648
Domain Number 1 Region: 24-237
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-50
Family Glycosyl hydrolases family 16 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266779.Meso_0648
Sequence length 253
Comment (Mesorhizobium BNC1)
Sequence
MAENCFRRVLVIASVLAGGTGVAFSQTAGTSFFDDFDSFDRSRWYVSDGWANGEWQNCTW
SKSEVSVAGGIVTLGYEKKPSGNRQYSCAEIQTTARFGYGVYEARMKTDEGSGINAAFFS
FTNSPHDEIDFEVLTKDTSKVSLNTYVSGKPHHGSTVDVPGGTTQFNHYAFVWEEGRLRW
YVNGKLVHEATGTDLPVNPQKIFFSHWGSETFTDWMGAFADPGRKLEMQVDWVAYTAPGE
ACQFPESVACSLN
Download sequence
Identical sequences Q11KM7
WP_011579991.1.76240 266779.Meso_0648 gi|110633005|ref|YP_673213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]