SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266779.Meso_3093 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266779.Meso_3093
Domain Number 1 Region: 9-178
Classification Level Classification E-value
Superfamily PRTase-like 1.04e-47
Family Phosphoribosyltransferases (PRTases) 0.000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266779.Meso_3093
Sequence length 180
Comment (Mesorhizobium BNC1)
Sequence
MPVVRGKEIEVLYSASTIARRNLELAKEIAARDYTDLLVISVLKGSFIFAADLIRAMHDA
GISPEVEFIMISSYGAGTTSGGIKVLRDIDNDVSGRDILLIDDILESGKTLQYTRDLMLS
RGAKSVSIAVLLDKHSRRQASLEADFVGFECPDYFVVGYGMDVAHAFRELPFVGIVKGEA
Download sequence
Identical sequences Q11DR0
gi|110635422|ref|YP_675630.1| 266779.Meso_3093 WP_011582406.1.76240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]