SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266779.Meso_4118 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266779.Meso_4118
Domain Number 1 Region: 18-169
Classification Level Classification E-value
Superfamily DR1885-like metal-binding protein 2.35e-20
Family DR1885-like metal-binding protein 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266779.Meso_4118
Sequence length 185
Comment (Mesorhizobium BNC1)
Sequence
MCSTKGQALERGQLLVNRALLRAALAIFVLATQVEASDGVQDHGKPPPILTVEHAEILVA
DNEDVGAEGYLTIWNGTNQQISLEAIRSDAFGKISILRTEMSSGQTSTGPVEGIVPVPGH
AELTMRPSGIRLLLQDPLPRNDRLADSRFTLVFEGGQKLEVTADVVQSRDQLTVHHHGQG
DVAID
Download sequence
Identical sequences Q11NA5
gi|110346932|ref|YP_665750.1|NC_008242 gi|110346932|ref|YP_665750.1| WP_011578584.1.76240 266779.Meso_4118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]