SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266779.Meso_4257 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266779.Meso_4257
Domain Number 1 Region: 73-264
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000119
Family Vibrio cholerae sialidase, N-terminal and insertion domains 0.06
Further Details:      
 
Weak hits

Sequence:  266779.Meso_4257
Domain Number - Region: 458-551
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.00165
Family STM3548-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266779.Meso_4257
Sequence length 757
Comment (Mesorhizobium BNC1)
Sequence
MLPIVAYLDKLTVAPGERLAVMAGSFGAHTYRADLRRIIQGDTNPQGPGYKDEAIALDLG
GERPAEAKGFYPGSCVVVPGRGMLSNLDDFTLAAVASPTLLDERERTVIAMPGFARIGID
AEGHVFAEALGRRLATTGRVTRNMWHVLSLAYSGGDGRLTLSISAESDAAGEDGQLEAIS
VPATAAPSGATEILIAATRGPNGRPGTFFDGKIDRPALFSAAVAHDTLRRLLADFERLSR
TRNLRAAWDFSRKISTQTICDVSPFQLHGRIHNAPARAMTGWLWKGQDLDWKKRPDLYSA
IHFHSTDMYDAAWTVDFTFTVPEGLGSGVYAVRLVPDGDEEAAYYCVFALRPPREQASGN
TVAFLFPTCSYLAYANHRLGMDVPGTEIGMGRAVELDRHHMFLQANPGIGFSVYETHDDE
SGVFHSSRLRPIVDLQPKVRSFLGGFGSNVWQFNADTHILGWLDHIGQDYDVITDEDLHA
EGLQLLGRYNVILTGTHPEYHTGNMIAALQGFTDRGGRLMYLGGNGFYWVVSFSEDMPGI
MECRRSEAGIRPWEPGHGQFYHAFTGEYGGLWRRNGRPPNHLCGVGMTSQGFDICEPYVL
SPAARDPRAAFIFEGLSKTAKIGDFGLAGGGAAGLEVDRADAAQGTPAHALVLASSTRHT
DIYLMTPEDLLDPTPDWSGTQADIIRADLTFFETAGGGAVFSTGSIAWAGSMAWNGYENE
IAYITANVLRRFDNPDRFRMPGGREDGQPVETRSTES
Download sequence
Identical sequences Q11MX7
WP_011578712.1.76240 266779.Meso_4257 gi|110347060|ref|YP_665878.1|NC_008242 gi|110347060|ref|YP_665878.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]