SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266834.SM_b20689 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266834.SM_b20689
Domain Number 1 Region: 1-255
Classification Level Classification E-value
Superfamily DNase I-like 3.93e-76
Family DNase I-like 0.0000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266834.SM_b20689
Sequence length 257
Comment (Sinorhizobium meliloti)
Sequence
MKIATFNINGVNKRLDILLTWLGTAEPDVVCLQELKATDGQFPRAAIEAAGYGAVWRGQA
AWNGVAILARDREPVLTRTGLPGDSSDTQSRYIEAAVNGILIASLYAPNGNPQPGPKFDY
KLAWHLRFNQHAAALLETGVPVVLAGDYNVVPEPRDIYPTRSYDDNALVQPESRAAFRSL
VDQGWLDALRKIHPKEELFTFWDYRRNRWQRDAGLRLDHILLSRKLRRRLTGAGIDREIR
ALEGSSDHAPVWVSMRD
Download sequence
Identical sequences Q92TU9
NP_437936.1.96377 WP_010976212.1.4234 WP_010976212.1.787 gi|470186781|ref|YP_007614153.1| gi|16265144|ref|NP_437936.1|NC_003078 gi|470186781|ref|YP_007614153.1|NC_020560 266834.SM_b20689 gi|16265144|ref|NP_437936.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]