SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266834.SMa1245 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266834.SMa1245
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.5e-30
Family cAMP-binding domain 0.0086
Further Details:      
 
Domain Number 2 Region: 133-211
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.75e-21
Family CAP C-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266834.SMa1245
Sequence length 215
Comment (Sinorhizobium meliloti)
Sequence
MSDADLDRMLAHATARRVPQGDAVFEQGQRATSFFLLLHGRLKVTQVTEDGQQIIVRVVH
PGDLFGFAKALQRSDYPGTATAATESLALSWPTDLWPQFVEQNPHLAVSTMQTIGQRLEE
AHTRIREMSTQEVERRVAHAVLRLSRQAGKQEKGGVRIDFPISRQDIAEMTGTTLHTVSR
ILSAWEQKGLVEGGRQKLIICDLSGLAALADGGRD
Download sequence
Identical sequences Q5SF00 Q92Z31
NP_435925.1.96377 WP_010967658.1.18618 WP_010967658.1.58221 WP_010967658.1.58608 WP_010967658.1.72343 WP_010967658.1.78492 WP_010967658.1.92524 gi|16263132|ref|NP_435925.1|NC_003037 266834.SMa1245 gi|16263132|ref|NP_435925.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]