SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266834.SMc04247 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266834.SMc04247
Domain Number 1 Region: 5-319
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 7.14e-98
Family alpha-L-arabinanase-like 0.00000000212
Further Details:      
 
Domain Number 2 Region: 332-537
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-58
Family Beta-D-xylosidase C-terminal domain-like 0.0000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266834.SMc04247
Sequence length 541
Comment (Sinorhizobium meliloti)
Sequence
MTATIRNPILPGFNPDPSICRVGEDYYIATSTFEWYPGVQIHHSRDLVNWRLVRRPLERA
SQLDMRGNPDSCGVWAPCLSYCDGLFWLVYTDVKRLDGNFKDAHNYIVTAEAVEATWSDP
VYVNSSGFDPSLFHDDDGRKWFLNMQWNHRSESFAGSPKSPAFDGILLQEWDERTRKLVG
PVKNIFAGSPLGLVEGPHLFKRDGWYYLTVAEGGTGYDHAVGMARSRTIDGPYEMHPNVH
LITSKDHPEAALQRAGHGQYVETPDGQAYHTHLCGRPLPPQRRCTLGRETALQKCVWRED
GWLYLENGGPVPGVTVPAPGAAGTVAERVLFETDFDEQVLPPEFQWLRTPVPERIFSLAA
RTGHLRLFGRESIGSWFEQALVARRQEHHSFRAEAVVDFAPDTYQQVAGLTHYYNRHKFH
ALGVTRHETLGRVLTILSCPGDFPNGRLTYPVGSGFAVPDGPVQLAMEVRDNDLQFFWRG
AAQAEWLTIGPVLDAGVISDEGGRGEHGSFTGAFAGIFAFDISGCATPADFDRFRYQALS
V
Download sequence
Identical sequences A0A0E0UD62 A0A222KFP1 F7X638 Q92P74
gi|384535866|ref|YP_005719951.1| 266834.SMc04247 gi|15965670|ref|NP_386023.1| gi|433613700|ref|YP_007190498.1| gi|384529794|ref|YP_005713882.1| gi|334316610|ref|YP_004549229.1| NP_386023.1.96377 WP_010969559.1.22199 WP_010969559.1.24285 WP_010969559.1.30341 WP_010969559.1.3110 WP_010969559.1.36292 WP_010969559.1.36834 WP_010969559.1.4234 WP_010969559.1.44594 WP_010969559.1.48083 WP_010969559.1.50755 WP_010969559.1.55094 WP_010969559.1.58221 WP_010969559.1.58608 WP_010969559.1.65778 WP_010969559.1.72343 WP_010969559.1.73540 WP_010969559.1.787 WP_010969559.1.79107 WP_010969559.1.86220 WP_010969559.1.90561 WP_010969559.1.92524 WP_010969559.1.94084 WP_010969559.1.99158 gi|470188877|ref|YP_007575188.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]