SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266835.mll0172 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266835.mll0172
Domain Number 1 Region: 17-190
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 8.9e-24
Family HD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266835.mll0172
Sequence length 203
Comment (Mesorhizobium loti)
Sequence
MTKMKDQPLIDELLKQELSALYRAEDRHYHNLAHIEAMLALAADHRALLSDPQAVEAAIW
FHDAIYDSKAKDNEARSAALAAQKLASRTDPERLDRIGAMILATATHQVPRFHDDAATRD
ASLFLDMDLSILGAAPHAFDAYERAVRREYGWVEEPMWRAGRGAVLKDFLARPRIFHTEE
FRQRFEPQARLNMARSLEALTAG
Download sequence
Identical sequences Q98NE8
gi|13470459|ref|NP_102027.1| 266835.mll0172 369167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]