SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266835.mll1288 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266835.mll1288
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily Flavoproteins 1.46e-40
Family Quinone reductase 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266835.mll1288
Sequence length 193
Comment (Mesorhizobium loti)
Sequence
MNILVLYAHPVETSFNAGLHRLIVERLTAAGHTIDDCDLYAEDFDPRLMRQERLDYHNQR
GAADPASPYVERLLRAEALVLSYPVWNYGFPAILKGFFDRVFLPGVSFRLVDGKVQPSLH
NIRKVAAVTTYGGSRFRAMVMGDPPRRLVKRMLRATVKPRAPVTYLAHYAMNLSTDQTRK
SFMTKVAASMDAF
Download sequence
Identical sequences Q98KW6
266835.mll1288 gi|13471346|ref|NP_102912.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]