SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266835.mll2811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  266835.mll2811
Domain Number - Region: 102-139
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0186
Family SMAD domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266835.mll2811
Sequence length 208
Comment (Mesorhizobium loti)
Sequence
MTEIGSMFSRFYDRSFLRVISGRKFLRVCSMAITLMGVLVFSTSALRAQEYTAQEIIDSG
HKFFGATSGGLATVVEKIFASYGLPNGYLLGEEGSGALIGGLTYGEGTLYTKNAGDHKVF
WQGPSLGWDFGGEGSRVMMLVYNLDDVSNLYNRYGGVAGSAYVVAGVGFNVLKNNNVLLV
PIRTGVGARLGVNLGYLKLTERATWNPF
Download sequence
Identical sequences Q98HL9
266835.mll2811 gi|13472494|ref|NP_104061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]