SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266835.mlr5264 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266835.mlr5264
Domain Number 1 Region: 59-270
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.11e-49
Family Glycosyl hydrolases family 16 0.00000912
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266835.mlr5264
Sequence length 293
Comment (Mesorhizobium loti)
Sequence
MNLDPKTTSTTAIDATSVAHETRQADLRRLGLIGGLVLAALGSLFAAPAHAQDIQSAPSF
VDDFKSFDKSRWYVSDGWSNGSHQNCTWSKGLVELSDGVLSLGFEKQKLKDREFACGEIQ
TKQRFGYGTYEARLKTDTGSGLNAAFFTYIGPSDKQPWDEIDFEILTKDTSKVQVNAYID
GKGKNEKLVEVPGGTDKAFNDYAFVWEKDSLRWYVNGQLVNTITDPAKLPSHAQKIFFSL
WGSETMKGWMGAFADPGRKLSLQVERVAFTALGEPCQFPESLVCSVKELGKTN
Download sequence
Identical sequences Q98C78
266835.mlr5264 WP_010913082.1.45716 gi|13474389|ref|NP_105957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]