SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266835.mlr8257 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266835.mlr8257
Domain Number 1 Region: 3-253
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.66e-46
Family Lysophospholipase 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266835.mlr8257
Sequence length 289
Comment (Mesorhizobium loti)
Sequence
MSPTFGIAFGGGGARGLAHIHVIEALDELGIKPVAIAGSSIGAIMGAGMAAGMTGKDIHG
YARSILGRRAEVASRMWRARPGTIAEAMQNGIRVSQFNVERILKAFLPEAIPETFAELKI
PLKVTATDYFGHKLAVFDEGDLHSALAASAAIPAVFRPVTRDGRLLIDGGIYNPVPFDLI
ENDADIIIGVDVVGAPEEADRKHPTSVDLMFGATQLMMQSIIANKLKQCRPDILVRPAVS
KYRVLDFLKIDALMNETADIKDQLKREVERVVEARNGAAIKGRRGKKAG
Download sequence
Identical sequences A0A1A5ID87 Q983M7 W9E646
WP_010915479.1.100680 WP_010915479.1.29505 WP_010915479.1.29585 WP_010915479.1.45716 WP_010915479.1.62138 WP_010915479.1.7437 WP_010915479.1.86590 266835.mlr8257 gi|13476823|ref|NP_108392.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]