SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266835.msl6002 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  266835.msl6002
Domain Number - Region: 17-56
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0275
Family Mitotic arrest deficient-like 1, Mad1 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266835.msl6002
Sequence length 64
Comment (Mesorhizobium loti)
Sequence
MIAATGTSKVRSLLERIATDETLPELARELFGLHGREYDRLEDEIEKVEARLMAWHRTNE
CSRA
Download sequence
Identical sequences Q98AH1
gi|13475015|ref|NP_106573.1| 266835.msl6002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]