SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266940.Krad_2314 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266940.Krad_2314
Domain Number 1 Region: 54-165
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000162
Family HD domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266940.Krad_2314
Sequence length 239
Comment (Kineococcus radiotolerans SRS30216)
Sequence
MAEPDASSEPVPSVPPGAAATWRQVSWLQQAAQSVRGGLQVLDVITEAVAPAIASHSVRV
LRYAHALACSEMAQERLQVSRSPAAFASYLDDGTLLTACLLHDAGATAVGASWQRFEVQG
ADRAAAFARAHGYSEDQVRHIWEAVALHTSPHIAERIHPLARWVRGGVLADFGTDLIPPD
LRRRTEAEVPRLDVERTLSGIVVEQALRDERRAPSGSWPADLLAAHRASADADARLSAF
Download sequence
Identical sequences A6WAF6
gi|152966275|ref|YP_001362059.1| 266940.Krad_2314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]