SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266940.Krad_3375 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266940.Krad_3375
Domain Number 1 Region: 99-248
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.99e-35
Family RecO C-terminal domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 19-95
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.74e-21
Family RecO N-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266940.Krad_3375
Sequence length 269
Comment (Kineococcus radiotolerans SRS30216)
Sequence
MSGTGSRGTRGSSIGGAKSYRDEAVVLRTAKLGEADRIVSLLTRHHGRVRAVAKGVRRTS
SRFGARLEPFTCVDVQLHRGRSLDTVTQADVLAPYGQVLVADYGLYTVGHALLETAERFT
EVERETATQQYLLLVGALRSLSRREHDASLVLDAYLLRSLAVAGYAASFGDCARCGEAGP
HAAFNVSAGGAVCPSCRPPGSAAPDPATLELLAALLSGEWALADAVEDRCRREGSGLVAA
FLQWHLEHGIRSLRHVEREPHEPPVPLAR
Download sequence
Identical sequences A6WDF0
gi|152967319|ref|YP_001363103.1| WP_012086902.1.7041 266940.Krad_3375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]