SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266940.Krad_3857 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266940.Krad_3857
Domain Number 1 Region: 12-255
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.3e-18
Family Glycosyl hydrolases family 16 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266940.Krad_3857
Sequence length 257
Comment (Kineococcus radiotolerans SRS30216)
Sequence
MDRLPLLDPTAAPFADDFTAGSPDPGRWVDHYLPHWTTPDRSRARCAPTPGGLELRIEAD
QPDWRPEDAPLRVSNLQTATFSGPAGSTRGTHRHRPDGLTVRTPTPTRLLWAPREGQVDV
RVTASLDRGCMLAVWLVGTEHESPGDSGEVCVCEIDADAVGETSTRVRTGVKAHHDPRLR
TEVTEVVVPVGAGQAHWWSARWNASGVVVACDERVVFTSAQHVRGPQQLMVDLFEVVAPG
PAGEYPKTAVVHAVRGS
Download sequence
Identical sequences A6WET1
WP_012086398.1.7041 gi|152967800|ref|YP_001363584.1| 266940.Krad_3857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]