SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266940.Krad_4516 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  266940.Krad_4516
Domain Number - Region: 57-91
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0298
Family Nuclear receptor ligand-binding domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266940.Krad_4516
Sequence length 115
Comment (Kineococcus radiotolerans SRS30216)
Sequence
MTQTPTHQRASADTSADTSAHVSAGVTALSGATPEDEDPATRAARARHTNTQRAAYAAQA
LQHHTRASHSHAEDLQQALVELLTDLHHLCHTCDLDLAPLYQAATLVYDREAHAA
Download sequence
Identical sequences A6WGN6
WP_012002047.1.7041 gi|157283831|ref|YP_001468099.1|NC_009806 266940.Krad_4516 gi|157283831|ref|YP_001468099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]