SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 267377.MMP0281 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267377.MMP0281
Domain Number 1 Region: 152-457
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.29e-30
Family RecA protein-like (ATPase-domain) 0.029
Further Details:      
 
Domain Number 2 Region: 21-145
Classification Level Classification E-value
Superfamily PIN domain-like 0.000000000000106
Family 5' to 3' exonuclease catalytic domain 0.091
Further Details:      
 
Domain Number 3 Region: 503-551
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000402
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 267377.MMP0281
Sequence length 630
Comment (Methanococcus maripaludis S2)
Sequence
MSIEEINQNLNENKKFKDCKITVDTCVVIDGRITELILDGRIEKCKIIVPEAVISELEAQ
ANKGREIGYFGIEELKKLVTVAKENEILIEYYGERPSTGEVSLARAGEIDAMIRKVAKDT
DSILFTSDKIQYNLAIAQNIDAHFLKVHEEKVALKLIEYFDEITSSVHLKENCLPYVKKG
RPGKVRLIPFADEIMDRTEIKVIIDNILKYTEQNHGLVEIERRGATVIQLGNLRISIARP
PFSEALEVTAVRPITKVSLEDYNLSEDLKVRLDSAEGIFVSGAPGSGKSTFVSALAERYK
NMDKIVKTMESPRDLQVDEEITQYAPLEGSMEKTCDILLLVRPDYTIYDEVRKTKDFEIF
ADMRMAGVGMVGVVHASKAIDSIQRLIGRVELGIIPQIVDTVVFIENGKIGKVYEVEFNV
KVPHGMKEADLARPVIEVVDFLTKTPEYEIYTYGEQVVVMPIKETTESRGAVLAYAEEKI
SEVLKKHLPKKSRPDIRVVNKDTVEVKVLEKFIPAIIGKGGKEISKLEEITGLRISVREK
DEVVENEKDFETYEFINDYESTKLTQTGKHVIVELGEDYIGANIKIYIEGEYACSATVSS
NGTVNISKKTAIGKDLANAMKKGKDIYVEF
Download sequence
Identical sequences Q6M0I9
267377.MMP0281 gi|45357844|ref|NP_987401.1| WP_011170225.1.40991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]