SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 267377.MMP0433 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267377.MMP0433
Domain Number 1 Region: 4-159
Classification Level Classification E-value
Superfamily Flavoproteins 1.57e-24
Family Flavodoxin-related 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 267377.MMP0433
Sequence length 164
Comment (Methanococcus maripaludis S2)
Sequence
MDEKKLVIYYSLFENTEYVANLISENTGADLLKIETVAEIPKKGLAMFLELGRFLLFRKM
PEIKEISVNLDEYDTIFIGTPVWAGNMAAPLKTFFSKYKFDGKKVAVFCTAGKTIGNTLE
NMKKELIDNELIGGTVFLDVLNHKEETENYVKEWLTTMYRSKED
Download sequence
Identical sequences Q6M039
gi|45357996|ref|NP_987553.1| 267377.MMP0433 WP_011170377.1.40991 370339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]