SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 267377.MMP0717 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  267377.MMP0717
Domain Number - Region: 76-167
Classification Level Classification E-value
Superfamily Bromodomain 0.00772
Family Bromodomain 0.02
Further Details:      
 
Domain Number - Region: 4-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0299
Family CAP C-terminal domain-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 267377.MMP0717
Sequence length 178
Comment (Methanococcus maripaludis S2)
Sequence
MVSQDDILYEFYNNDGILSTEQLKELSGISKEESIRSISKSMNSLIQKKLIGKVKGPKNS
TIYFLTNPYYFLCDDNERIKHEKTHCLNVIKKVMEHHDECKIFEKQDMIILKFSATYQIR
NHLKLIKSIIDMFGNCLKYVLHDNYILVTGKTHLEIDVFNINHFLKEEKEINFKNTIK
Download sequence
Identical sequences G0H3M3 Q6LZB2
267377.MMP0717 WP_011170661.1.40991 WP_011170661.1.41672 gi|45358280|ref|NP_987837.1| gi|340623703|ref|YP_004742156.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]