SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 267608.RSp1284 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267608.RSp1284
Domain Number 1 Region: 10-318
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 7.85e-105
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000492
Further Details:      
 
Domain Number 2 Region: 320-469
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.24e-21
Family Glycosyl hydrolases family 32 C-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 267608.RSp1284
Sequence length 473
Comment (Ralstonia solanacearum)
Sequence
MLDTLALDVIEDPWRQAYHLCPPQGLLNDPNGLIFWRGAYHVFYQWNPHGCRHENKHWAH
ARSTDLIHWELLPPALAPDAPYDEDGCYSGCAVEVDGDLFLLYSGNVRSPDGGRASYQCL
AHSRDGVGFDKLGPVINGVLPGYTGHFRDPKAWRQGDHWYAVLGAQRTDLTGTVLLLKSP
DLRQWQLLGELIAPALPCYMYECPDLFTLDRRTVLVCCQQTMETGAGGNRRSDVAGYMLG
QIDLERAQFPHSGFRPLDQGFDFYAPQTLLGPDGRRLLIGWMGLPVQPQTPTVASGWMHC
LTLPRELTLEGDQLMQRPARELAMLRSATIRVPDVDLEANTAFVLPQPDGGAWELDLSIR
AECPAGWVLHLFDSAQQSLSLAFDGVGTLTLRRHCPMAGQINERKTCGIGGPVTRLQVFI
DRSSVEMFVNDGVAVLTTCCYPAAEPEAPRLQARQPLSLRDIHVWPLEDRLAR
Download sequence
Identical sequences A0A223GVW7 Q8XQE3
gi|17549503|ref|NP_522843.1| WP_011004566.1.81933 gi|17549503|ref|NP_522843.1|NC_003296 267608.RSp1284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]