SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 267747.PPA0685 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267747.PPA0685
Domain Number 1 Region: 332-444,513-764
Classification Level Classification E-value
Superfamily Sialidases 1.04e-77
Family Sialidases (neuraminidases) 0.0000302
Further Details:      
 
Domain Number 2 Region: 203-329
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000822
Family Laminin G-like module 0.03
Further Details:      
 
Weak hits

Sequence:  267747.PPA0685
Domain Number - Region: 45-156
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00285
Family Laminin G-like module 0.029
Further Details:      
 
Domain Number - Region: 442-498
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0251
Family YVTN repeat 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 267747.PPA0685
Sequence length 771
Comment (Propionibacterium acnes KPA171202)
Sequence
MTITDTYTEELAIDLTGSALLPARKGMDVQRIDGEDGSLLVEFSATSSGCLFELVGKNGR
LSVDVDEDRLLGRIDLNGESRSLDAEDALGMADGTIHSVGLTADETGTHLFADGYETFSA
TLRVWCQDLGATNIVINPSGVLDVRRFKMWNSALSLQAMAAKAPTATPFVEFAGSELSAR
DARRIGELAHGALRARTRLRGKGQGGTVLAAQGSAGELSFEIVNGDLLLHVEVDDEPIAH
VRAPGKWDDGNWHDLVAISGRGAIDLYVDGFLVAHEPGEAFFADLGKVERVTVGKDLEGA
RLFGEAQTASIFSSALTDAQVKRLANVAPLRTQALFDTGYLGSKSYRIPSLIRLDSGSFI
AGADQRVSIANDSPNDINFVIRRSEDGRRWDEAQIVLEYPGEGALGASVIDSVLFQDHNS
GRVFCLIDQFPGGVGQPNAEPGSGFDEQGRQLLFDRDATAYVIDAEGIVTTESGEPTDYT
VDETGNVFAAGAPAGNIHLATGVDPHESLLTLRTCNLILIHSDDDGRTWSRPINLNPALK
QPWMRFLGTSPGNGIQLEHGTHRGRLLAPVYYNHEEGKTFSCAAVYSDDGGQTWNLGKSP
NDERELFGKIVSSRNLNDDRGSTHESALVETPDGVVHSFMRNQHPSGRVAHAASVDGGET
WGEVTFVEQLTEIFSQPNAISVRDELGTESVVFANASMMLPFRGCGVLRQSFDGGKTWPH
NRVLNPRHHVYQCMTQQDEQTLLVLWEREWQGLFLTEVPLSWLTTSRSTLE
Download sequence
Identical sequences A0A1W9TXJ2 A0A2I1W157 Q6A9X5
gi|386023642|ref|YP_005941945.1| gi|50842172|ref|YP_055399.1| gi|387503063|ref|YP_005944292.1| WP_002515306.1.101196 WP_002515306.1.102131 WP_002515306.1.1505 WP_002515306.1.18363 WP_002515306.1.23000 WP_002515306.1.27635 WP_002515306.1.28533 WP_002515306.1.2928 WP_002515306.1.29382 WP_002515306.1.29850 WP_002515306.1.30003 WP_002515306.1.31800 WP_002515306.1.32488 WP_002515306.1.34331 WP_002515306.1.36413 WP_002515306.1.38538 WP_002515306.1.41101 WP_002515306.1.41264 WP_002515306.1.42227 WP_002515306.1.43449 WP_002515306.1.48475 WP_002515306.1.49294 WP_002515306.1.49524 WP_002515306.1.50533 WP_002515306.1.54292 WP_002515306.1.56441 WP_002515306.1.56454 WP_002515306.1.56826 WP_002515306.1.57145 WP_002515306.1.58125 WP_002515306.1.59962 WP_002515306.1.60466 WP_002515306.1.60649 WP_002515306.1.60667 WP_002515306.1.66916 WP_002515306.1.67054 WP_002515306.1.67247 WP_002515306.1.70496 WP_002515306.1.7197 WP_002515306.1.73086 WP_002515306.1.74417 WP_002515306.1.74746 WP_002515306.1.74916 WP_002515306.1.767 WP_002515306.1.76841 WP_002515306.1.83430 WP_002515306.1.86359 WP_002515306.1.87452 WP_002515306.1.90730 WP_002515306.1.91146 WP_002515306.1.98214 267747.PPA0685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]