SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 267747.PPA0880 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267747.PPA0880
Domain Number 1 Region: 2-215
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.89e-34
Family Decarboxylase 0.000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 267747.PPA0880
Sequence length 217
Comment (Propionibacterium acnes KPA171202)
Sequence
MPRLQIALDTYDLPSALAPLATAVDQIDIIECGTILVLAEGMDAVRAIRAAYPDKTILAD
VRIAEAGAKIARMCFEAGADLVSCVAGASLTTIDQVCKVAGEFGGEVQVELADEWYDAER
ARRWRTLGVQHVIVKRSRDREAAGDLSWKPEDLGRVDELAGMGFTVTVTGGITPEDLPVF
AGHPVGIVIAGRSIVAADDPKAAAQRLRSTLDEVWPQ
Download sequence
Identical sequences A0A0E1YF69 A0A2I1W443 Q6A9D0
gi|50842367|ref|YP_055594.1| 267747.PPA0880 WP_002523835.1.101196 WP_002523835.1.14952 WP_002523835.1.17969 WP_002523835.1.18363 WP_002523835.1.28533 WP_002523835.1.37742 WP_002523835.1.43449 WP_002523835.1.49294 WP_002523835.1.50533 WP_002523835.1.51523 WP_002523835.1.53219 WP_002523835.1.56454 WP_002523835.1.60667 WP_002523835.1.67054 WP_002523835.1.67213 WP_002523835.1.67247 WP_002523835.1.70135 WP_002523835.1.74746 WP_002523835.1.767 WP_002523835.1.80166 WP_002523835.1.87452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]