SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 267747.PPA1471 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267747.PPA1471
Domain Number 1 Region: 9-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-45
Family Ribonuclease PH domain 1-like 0.000000614
Further Details:      
 
Domain Number 2 Region: 322-493
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.61e-43
Family Ribonuclease PH domain 1-like 0.00000107
Further Details:      
 
Domain Number 3 Region: 153-261
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.5e-28
Family Ribonuclease PH domain 2-like 0.0000114
Further Details:      
 
Domain Number 4 Region: 475-575
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.91e-23
Family Ribonuclease PH domain 2-like 0.0000216
Further Details:      
 
Domain Number 5 Region: 583-670
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.18e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 265-345
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 4.97e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00069
Further Details:      
 
Domain Number 7 Region: 648-722
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000293
Family Cold shock DNA-binding domain-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 267747.PPA1471
Sequence length 733
Comment (Propionibacterium acnes KPA171202)
Sequence
MEGPGLEFTEAIIDNGKLGKHVVRFEAGLLAQQADGSAAVYLDGDTMLLSATTAAKTPRD
SIDFFPLTVDVEERMYAAGRIPGSFFRREGRPSEGAILACRLIDRPLRPSFVKGLRNEVQ
VVVTVMALNPAVYYDVVAINAASMSTQLAGLPFSGPIGGVRMALIDDQWVCFPSVDQRKE
STFDMVVAGRVLADGDVAIMMVEAESTPATWGLVRGGRTAPTEEVVATGLEAAKPFIKVL
CDAQVALAAKLPKETYDFPVFKDYEDDVYAAVEEKAADELSRIEQIAAKLERQEAESELK
ARIKAELAETFPEREAEISGAFKAVMKKIVRKRVLDEGVRIDGRGPRDIRSLSAEVGIIP
RVHGSALFQRGETQILGVSTLNMLDMEQKLDTLSPENTRRYMHNYNMPPYSTGETGRVGS
PKRREIGHGNLAERALIPVLPTREEFPYAIREVSEAIGSNGSTSMGSVCASTLALLNAGV
PLRASVAGIAMGLMSETDEDGKTKYLALTDILGAEDALGDMDFKVAGTSEFVTALQLDTK
LDGIPADVLAGALKQAKEARTAILEVMNEAIDSPDEMAPTAPRIITVHIPVDKIGEVIGP
KGKMINQIQDDTGANISIEDDGTIFIGADNGDSAESARSMINAIANPQMPEVGERYLGTV
VKTTSFGAFVSLLPGKDGLLHISKMRDLNDGKRVEAVEDVLSVGQKIQVEIAEVDDRGKL
SLVLASDEDDADE
Download sequence
Identical sequences A0A0E1YTM4 A0A1J4WXN0 A0A1N5A296 A0A2B7I790 Q6A7P6
267747.PPA1471 gi|365974348|ref|YP_004955907.1| gi|50842950|ref|YP_056177.1| gi|387503851|ref|YP_005945080.1| gi|365965412|ref|YP_004946977.1| gi|407935894|ref|YP_006851536.1| WP_002516891.1.102089 WP_002516891.1.102131 WP_002516891.1.14952 WP_002516891.1.15006 WP_002516891.1.1505 WP_002516891.1.17579 WP_002516891.1.17969 WP_002516891.1.18363 WP_002516891.1.22959 WP_002516891.1.23000 WP_002516891.1.26091 WP_002516891.1.26893 WP_002516891.1.26956 WP_002516891.1.27635 WP_002516891.1.28533 WP_002516891.1.2928 WP_002516891.1.29382 WP_002516891.1.29850 WP_002516891.1.30003 WP_002516891.1.31063 WP_002516891.1.31624 WP_002516891.1.3171 WP_002516891.1.31800 WP_002516891.1.32488 WP_002516891.1.34331 WP_002516891.1.36413 WP_002516891.1.37742 WP_002516891.1.38538 WP_002516891.1.41101 WP_002516891.1.41264 WP_002516891.1.42227 WP_002516891.1.43585 WP_002516891.1.43983 WP_002516891.1.44257 WP_002516891.1.45324 WP_002516891.1.48202 WP_002516891.1.48475 WP_002516891.1.49294 WP_002516891.1.49524 WP_002516891.1.50101 WP_002516891.1.50375 WP_002516891.1.50378 WP_002516891.1.50533 WP_002516891.1.51523 WP_002516891.1.53219 WP_002516891.1.54292 WP_002516891.1.5458 WP_002516891.1.56441 WP_002516891.1.56454 WP_002516891.1.56826 WP_002516891.1.57145 WP_002516891.1.58125 WP_002516891.1.59251 WP_002516891.1.59962 WP_002516891.1.59982 WP_002516891.1.60466 WP_002516891.1.60649 WP_002516891.1.60667 WP_002516891.1.66916 WP_002516891.1.67054 WP_002516891.1.67213 WP_002516891.1.67247 WP_002516891.1.69974 WP_002516891.1.70135 WP_002516891.1.70496 WP_002516891.1.7197 WP_002516891.1.72191 WP_002516891.1.73086 WP_002516891.1.74417 WP_002516891.1.74746 WP_002516891.1.74916 WP_002516891.1.7599 WP_002516891.1.767 WP_002516891.1.76841 WP_002516891.1.7771 WP_002516891.1.80166 WP_002516891.1.81031 WP_002516891.1.81478 WP_002516891.1.83430 WP_002516891.1.86359 WP_002516891.1.87452 WP_002516891.1.89010 WP_002516891.1.90730 WP_002516891.1.90935 WP_002516891.1.91146 WP_002516891.1.91610 WP_002516891.1.92292 WP_002516891.1.94227 WP_002516891.1.97417 WP_002516891.1.97839 WP_002516891.1.98061 WP_002516891.1.98214 gi|365963171|ref|YP_004944737.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]