SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 267747.PPA2056 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267747.PPA2056
Domain Number 1 Region: 35-270
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.65e-33
Family Glycosyl hydrolases family 16 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 267747.PPA2056
Sequence length 445
Comment (Propionibacterium acnes KPA171202)
Sequence
MTLITRRSVLGAAVLTAAVPVVADHDRAIAADADIDLAGWTLLGVGDEFTDPTHSSAQWH
RGLWYPHSGSGLFRDANVSFSGGQLHLAARAEQVDSFSYTFGAVESVFDVPGLCTYVEVR
AKALPSAARVLSAIWMQSSALDGGPSLLTGAEPNPELDVEETFDYTKMNIATHVWPDNTE
VTHRRFGGHAYPVGVDISRDYHTYGVERRDGQLRFYFDRHLAWETKPGDPSLWRMSRHMV
LSLEGHLGAPVVHRLPASFDIDYVRAWYAPNPALEPGDYRLTSADGRFLAFHDGVPTLQA
QPQTWCVVRHDDCTYSLSTPGGAVLGLDAEVGKHEVVVGSGRRTTSDTEGSLNRWHLLAN
GAGRTLHSKFTGLPIVVADSRVVEGSDLATAAVWTLTTTIPSPLPGPSATSIPVPSTPAR
STSAAADAAPSRPGLPRTPLPRTGV
Download sequence
Identical sequences Q6A644
gi|50843500|ref|YP_056727.1| gi|387504410|ref|YP_005945639.1| 267747.PPA2056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]