SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 267748.MMOB0290 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267748.MMOB0290
Domain Number 1 Region: 91-135
Classification Level Classification E-value
Superfamily Acid proteases 0.0000377
Family Retroviral protease (retropepsin) 0.038
Further Details:      
 
Weak hits

Sequence:  267748.MMOB0290
Domain Number - Region: 152-185
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0497
Family EB1 dimerisation domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 267748.MMOB0290
Sequence length 211
Comment (Mycoplasma mobile 163K)
Sequence
MPNRIFQKIHENKIIIKVILVNNIDILKFWKNNSHLTEKVNDFVKGKILQRYGKLVDISQ
EEFFKILNEDIPLWSKWLEFLKSIEKYQKEIFALIDTGATSSAISQEIANELGLISIGKS
SVQTASNRLITSKYLVSLSFLTESTLLLPSIEKNFQEKSFYTNKLVPFEQIIEVTSLENL
RQSQNIDMLIGMDILKNTHFTIFSDNAMISV
Download sequence
Identical sequences Q6KIR1
267748.MMOB0290 WP_011264549.1.31918 gi|47458864|ref|YP_015726.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]