SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 267748.MMOB4640 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267748.MMOB4640
Domain Number 1 Region: 10-84
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 3.27e-18
Family Glucose permease domain IIB 0.0019
Further Details:      
 
Weak hits

Sequence:  267748.MMOB4640
Domain Number - Region: 63-145
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0192
Family Legume lectins 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 267748.MMOB4640
Sequence length 533
Comment (Mycoplasma mobile 163K)
Sequence
MKQSEFKNSAELIIEAVGGKENISIFYHCATRLRFKLTDQSKINVNKIKAIKLAKGYNLE
GEENQIIFGAGTVNKVHDELQNLTQKSTNQTSSPKQKHIWWNKNISFWSNLFLNLRWFVR
SFAEIFIPLIPIFIAGGLSLALTNLVKAVADVNINQTAKSAVFFFELIGAGILGSLPAFV
GYTSMKKYGGTPLIGLAIGIILVAPNLLNAYLVTGTLTSFPVGQIGITPGTQTNGGTIAV
FALFPALPEFFQFRLIGYQAEIFPVLAIVALAFFVEKFLKRYTPEALAIIVVPLITIVFT
LFLGFWIIGPIFKFISIGLTLAFSGIFQFTNFAWFGLGGAILGFAYPFLVVTGLHQGFLP
IEAQLIARDGFTWITSIATISNISQGVVGLTLAIVFFLKKEKKNASLAISGGVSANLGIT
EPILFGINIPLKFAMVAAACGAAVGGYWVGMTQTMASSIGSASWIGFIQFDITATRLQAF
IGNRSAALTNLAPIYNIAIASILSVFSSIGFTLIFLKTKWGKNSYNKFLSIQN
Download sequence
Identical sequences Q6KHI0
267748.MMOB4640 WP_011264984.1.31918 gi|47459299|ref|YP_016161.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]