SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269084.syc0606_d from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269084.syc0606_d
Domain Number 1 Region: 12-162
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.45e-29
Family Single-domain sulfurtransferase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269084.syc0606_d
Sequence length 181
Comment (Synechococcus elongatus PCC 6301)
Sequence
MTSFSTPTNRQNTPLLSPNQLQFLIDRQEVLLLDVREVAEYQADHIAGSHLYPLSQITQL
PLPASDRPIVLTCQSGMRSQKAATQLQQRGLTITELQGGLNAWKQRGLPTIGQTANAPIS
LMRQVQLVAGSLVLISIILSLTLAHTWLGLSAFVGAGLVFAGLSGTCLLPNVLAAMPWNR
G
Download sequence
Identical sequences A0A0H3K0J1
gi|56750615|ref|YP_171316.1| 269084.syc0606_d WP_011242918.1.5740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]