SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269482.Bcep1808_7486 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269482.Bcep1808_7486
Domain Number 1 Region: 96-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000006
Family Laminin G-like module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 269482.Bcep1808_7486
Sequence length 247
Comment (Burkholderia vietnamiensis G4)
Sequence
MKLHAIALACTLGMVVAPAVTAEDQVPAQSVSIDLAAETVGAEPVNFIAAVGNWRIGADG
NRKVLTVDGSKWQRGQPSAGLADKARALYGERYAEFLDNVTAYAYFPIAVVKRIDDFRDG
EISLRFKGIAGRIDQGAGIVFNLKPNGDYLVLRANCLENNLVLFKYVHGVRSPVKWIRNT
PTDTGRWHDLKLEVNGVSVKGYLDGKLYLEDTLAAPISGRIGVWSKADSVMYFDDFRMIT
ATRRPVS
Download sequence
Identical sequences A0A228I8V1 A4JEG4
gi|134288085|ref|YP_001110249.1|NC_009229 gi|134288160|ref|YP_001110323.1|NC_009230 WP_011875849.1.49553 WP_011875849.1.63689 WP_011875849.1.92367 gi|134288085|ref|YP_001110249.1| gi|134288160|ref|YP_001110323.1| gi|134291517|ref|YP_001115286.1| gi|134295767|ref|YP_001119502.1| 269482.Bcep1808_1662 269482.Bcep1808_6113 269482.Bcep1808_6628 269482.Bcep1808_7486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]