SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269797.Mbar_A0001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269797.Mbar_A0001
Domain Number 1 Region: 258-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000144
Family Glycosyl hydrolases family 16 0.011
Further Details:      
 
Domain Number 2 Region: 34-239
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000023
Family Glycosyl hydrolases family 16 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 269797.Mbar_A0001
Sequence length 466
Comment (Methanosarcina barkeri fusaro)
Sequence
MFSIDIMINMNKKYLQLLMLSTLGLLLIANTAAADTYLNWCGKEWWVRSGTGNPGSNNWN
SSDNSVWVDENENLHLTIQKVGDMWYSTEVDTTSADYTYGVYSWTVSSPILNLDPNIVAA
MFYRHNDTNEIDIGATQWGWMYSDRLNYGVAPNSYQSAIPYDSPYQNATDVTYSFDWEPT
YVHFTAKLSNGTVISDWNCTDQTSIPHVAGGVAMQMWLMNHLAPINGQNAEMVLSDFSYV
PSSVAPDTPDAPDAPDTSDTYLNWCGREWWVRNVPGNPGGNNWSNSSNSVWVDENQNLHL
TIQKIGDIWYSTEVDTTSTDYIYGVYTCTVSSPILNLDPNIVAGMFFRHNDTNEIDIEAT
QWGGIYSDRLSYSVQPNAYQSAIPYDSPYQNATDVTYSFDWEPTYVHFTTKLSNGTVISD
WNCTDQTSIPHVTGGVAMQMWLMNHLAPINGQNAEMVLSNFSYVPS
Download sequence
Identical sequences A0A0E3QKZ3 Q46GJ7
WP_011305050.1.36239 WP_011305050.1.74748 269797.Mbar_A0001 gi|73667560|ref|YP_303575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]