SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269797.Mbar_B3754 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269797.Mbar_B3754
Domain Number 1 Region: 22-244
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.88e-37
Family Clostridium neurotoxins, the second last domain 0.039
Further Details:      
 
Domain Number 2 Region: 1137-1353
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.15e-36
Family Clostridium neurotoxins, the second last domain 0.042
Further Details:      
 
Domain Number 3 Region: 1055-1137
Classification Level Classification E-value
Superfamily PKD domain 7.06e-28
Family PKD domain 0.00019
Further Details:      
 
Domain Number 4 Region: 313-409
Classification Level Classification E-value
Superfamily PKD domain 1.47e-19
Family PKD domain 0.00077
Further Details:      
 
Weak hits

Sequence:  269797.Mbar_B3754
Domain Number - Region: 647-753
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0169
Family NodB-like polysaccharide deacetylase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269797.Mbar_B3754
Sequence length 1830
Comment (Methanosarcina barkeri fusaro)
Sequence
MVSKCFFLPVIVGISLLVSGVQAAPVTNGLVVYYDGNLSGSFLVDLSGNNNTGYATNVTS
GTNQLTGANYINLNGFNSSIDVSNNAQTNISSPISIEFIGSIHEFKPYGALVSKYDDDEI
TGWYLDCSAHPPYQQARFVMCAWNATSGTNSLYGDKSVGTLDAGQIYHIVVTYDSNTASI
YINGVNSGTSTWNLPIVGNSKNITIGSGSGIPNGNCSMYVFRLYNRALSPDEVWQNYVRD
RPIYMMTPTIIWSNPADITYGTALSSTQLNAVATDPVTGNTVTGNFTYDPAAGTILSEGT
QTLNVDFASNDTANYTNATANVTINVNPVPPVANFSYAMVNNSPLTIQFTDTSISGVNYQ
WNFGDGSSNVTLANPLHTFASPGAYSVQETVSNALGSSTKTQNVDVQYPTTNLDVGELQL
WTFDASKVSDVPNNIYTTTKNIPYTSNVSLKHNSTLGSIDSSCWHGDNGETYITGAYPTV
NQNLTFTMGIDSNSQWSYGYLHTSVADIGVRHASDGSYWIYSYWTNDTGSQLSSSYQIPA
TSVVNNKVTVSIHSYDSNRTNVITSGPALYVITPYTTEKTRKLPYTNVIQPLIYETFYAS
GTDGWVNVHLYNITQSIPRDIITPYARNDIMAFGLVCPNVTNNQLGTDFLISHNQSATVF
VSGGVDENEVEYNEYLFNHGFEEGIHFYPGLASQSLADSETIIDTEMDHVNSLFGAMPAS
WSSHANDDNITHAIYIYQRYGALYRTGYQGMGFISNSINLQNNTWYWWNISSARGAISPC
FTHQTDIDPAPLFAIDPDFFSTFVTNLNSNGINLVGFTNWYCSSMAQTAITNVLQYDENN
IKFQLNTSGGYPVNMNVQTMSSPLYLYCDAVSIPFNQTSDGIQFMSVGNGTYTLTNTSLA
TPSITWSNPGAITYGTALSSTQLNATASVPGTLAYHPAAGTILSAGTHPLQVIFTPTDST
NYTTATSSVSLAVNRATPLITWNTPSAISSGTSLSETQLNANASVLGNFTYNPASGTVLS
VGTHTLHVDFMPTDVVNYTNATANVTINVSEKLVLPVANFTASVTSGAAPLSVQFNDSSE
NATAWSWDFGDGQTSTVQNPSHTYSIPGTYTVSLNVSNADGYNISTKSNLITVNPNTPPV
TNGLVVYYDGSLSGNSLVDLSGNNNIGYATNVTSGTNQLTGANYIDLNGFNSSIDVSNNA
QTNISSPVSIEFIGSINEFKELGTLVSKYNDEKTGWYLSCSTADPNNHLRVALGLQSGAL
NMYNSDASLVAGQVYDIVLTYDNNTVSVYINGVNSGTRTWNSPIAGLTNNISIGSGTRNL
SYGNCSMYAFRLYNRSLSSAEVLQNYNSDHWRYSEYTTKVSPTIIWAGSVAITYGTALSE
AQLNANASVPGTFVYSPASGTIPGAGTHTLQTTFTPTDTTNYTMASSSVSLTVNKAIPLV
TWSNPADITSGTALGSTQLDAFASVPGSFAYNPVSGTVLRTGTHALKVRFTPADTTNYTT
VSNSVSLTVNKAIPLITWSNPADITSGTALSSTQLNANASVPGTFVYTPATGTVLNAGTH
TLHVDFTPADTASYKSASKDVTINVVSQKMIPIITWNTPADITYGTALDSAQLNALASVP
GSFAYTPALGTVLSAGMHNLSLDFTPADLKNHTMASGSVSLIVNKAAPLITWNNPADMSS
GTSLSETQLNAAASVPGSFAYTPAAGTILSAGTHTLQVTFTPTDTANYIPASSSVLINIV
NDAHAKSSSSNKKYNLVKQKILAPNSTQSSNLTEGIEKEIKSELGNEAIDQHNKSSKGLQ
TEQKETQNTPGFGIACGVACLFGVLLYKRE
Download sequence
Identical sequences A0A0E3QHL1 Q46GK4
gi|73663838|ref|YP_300084.1| gi|73663838|ref|YP_300084.1|NC_007349 269797.Mbar_B3754 WP_011302000.1.36239 WP_011302000.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]